ACIAD0226 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 75142a90ded6a066609a385042b78e4d.SwissProt.fasta
           9 sequences; 3,499 total letters



Query= ACIAD0226

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q8FFY2 Uncharacterized protein YegX [Escherichia coli O6:H1 (st...   132    7e-40
  P76421 Uncharacterized protein YegX [Escherichia coli (strain K...   130    4e-39
  Q8X7H0 Uncharacterized protein YegX [Escherichia coli O157:H7]       124    7e-37
  P25310 Lysozyme M1 [Streptomyces globisporus]                       89.4    3e-24
  P26836 Probable autolytic lysozyme [Clostridium perfringens (st...  84.0    3e-22
  P34020 Autolytic lysozyme [Clostridium acetobutylicum (strain A...  74.3    6e-19
  D4ANU4 N,O-diacetylmuramidase [Arthroderma benhamiae (strain AT...  59.3    5e-14
  P00721 N,O-diacetylmuramidase [Chalaropsis sp]                      51.2    3e-11
  O35604 NPC intracellular cholesterol transporter 1 [Mus musculus]   38.9    8e-07


> Q8FFY2 Uncharacterized protein YegX [Escherichia coli O6:H1 (strain 
CFT073 / ATCC 700928 / UPEC)]
Length=272

 Score =  132 bits (332),  Expect = 7e-40
 Identities = 82/269 (30%), Positives = 122/269 (45%), Gaps = 35/269 (13%)

Query  17   QLRLLYSPKF--LGIGFSLVMVILIY----VGFFYNQMASAQDY----------------  54
            QLR+    KF  L     L+ ++ IY    V FFY+     +DY                
Sbjct  2    QLRITSRKKFTVLLCALGLISIVAIYPRQTVNFFYSTAIQIKDYIHFYGYRPVKSFAIRI  61

Query  55   ----TVRGFDVSHHQGNIDWAKISPQK-----FQFVYLKATEGGDFQDPKFQENWLKARE  105
                T+ G DVS  Q  IDW +++  +      QF ++KATEG    DP F  NW  +RE
Sbjct  62   PASYTIHGIDVSRWQERIDWQRVAKMRDNGIRLQFAFIKATEGEKLVDPYFSRNWQLSRE  121

Query  106  YHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQI  165
                 GAYH++        QA  F+ TV       P V+D+E          ++++ + +
Sbjct  122  NGLLRGAYHYFSPSVSASVQARLFLQTVDFSQGDFPAVLDVEERGKLSAKELRKRVSQWL  181

Query  166  KVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRDYDGKPELKDDRQWLFWQYT  225
            K    +++   GK+PI Y    FYH  L G F   P W+  Y  +    D   W FWQ++
Sbjct  182  K----MVEKRTGKKPIIYSGAVFYHTNLAGYFNEYPWWVAHYYQRRPDNDGMAWRFWQHS  237

Query  226  SKSSIKGIEKPVDLNVYAGSLQHWQQFVN  254
             +  + GI  PVD NV+ G+++  Q FV+
Sbjct  238  DRGQVDGINGPVDFNVFNGTVEELQGFVD  266


> P76421 Uncharacterized protein YegX [Escherichia coli (strain 
K12)]
Length=272

 Score =  130 bits (327),  Expect = 4e-39
 Identities = 80/269 (30%), Positives = 120/269 (45%), Gaps = 35/269 (13%)

Query  17   QLRLLYSPKFLGI--GFSLVMVILIY----VGFFYNQMASAQDY----------------  54
            QLR+    K   +     L+ ++ IY    V FFY+      DY                
Sbjct  2    QLRITSRKKLTSLLCALGLISIVAIYPRQTVNFFYSTAVQITDYIHFYGYRPVKSFAIRI  61

Query  55   ----TVRGFDVSHHQGNIDWAKISPQK-----FQFVYLKATEGGDFQDPKFQENWLKARE  105
                T+ G DVS  Q  IDW +++  +      QF ++KATEG    DP F  NW  +RE
Sbjct  62   PASYTIHGIDVSRWQERIDWQRVAKMRDNGIRLQFAFIKATEGEKLVDPYFSRNWQLSRE  121

Query  106  YHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQI  165
                 GAYH++        QA  F+ TV       P V+D+E          ++++ + +
Sbjct  122  NGLLRGAYHYFSPSVSASVQARLFLQTVDFSQGDFPAVLDVEERGKLSAKELRKRVSQWL  181

Query  166  KVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRDYDGKPELKDDRQWLFWQYT  225
            K    +++   GK+PI Y    FYH  L G F   P W+  Y  +    D   W FWQ++
Sbjct  182  K----MVEKSTGKKPIIYSGAVFYHTNLAGYFNEYPWWVAHYYQRRPDNDGMAWRFWQHS  237

Query  226  SKSSIKGIEKPVDLNVYAGSLQHWQQFVN  254
             +  + GI  PVD NV+ G+++  Q FV+
Sbjct  238  DRGQVDGINGPVDFNVFNGTVEELQAFVD  266


> Q8X7H0 Uncharacterized protein YegX [Escherichia coli O157:H7]
Length=272

 Score =  124 bits (311),  Expect = 7e-37
 Identities = 78/269 (29%), Positives = 118/269 (44%), Gaps = 35/269 (13%)

Query  17   QLRLLYSPKFLGI--GFSLVMVILIY----VGFFYNQMASAQDY----------------  54
            QLR+    K   +     L+ ++ IY    V FFY+      DY                
Sbjct  2    QLRITSRKKLTALLCALGLISIVAIYPRQTVNFFYSTAVQITDYIHFYGYRPVKSFAIHI  61

Query  55   ----TVRGFDVSHHQGNIDWAKISPQK-----FQFVYLKATEGGDFQDPKFQENWLKARE  105
                T+ G DVS  Q  IDW +++  +      QF ++KATEG    DP F  NW  +RE
Sbjct  62   PASYTIHGIDVSRWQERIDWQRVAKMRDNGIRLQFAFIKATEGEKLVDPYFSRNWQLSRE  121

Query  106  YHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQI  165
                 GAYH++        QA  F+ TV       P V+D+E          ++++ + +
Sbjct  122  NGLLRGAYHYFSPSVAAPVQARLFLQTVDFSQGDFPAVLDVEERGKLSAKELRKRVSQWL  181

Query  166  KVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRDYDGKPELKDDRQWLFWQYT  225
            K    +++   GK+P+ Y    FYH  L G F   P W+  Y  +    D   W FWQ++
Sbjct  182  K----MVEKSTGKKPVIYSGAVFYHTNLAGYFNEYPWWVAHYYQRRPDNDGMAWRFWQHS  237

Query  226  SKSSIKGIEKPVDLNVYAGSLQHWQQFVN  254
             +  + GI   VD NV+ G+ +  Q FV+
Sbjct  238  DRGQVDGINGSVDFNVFNGTEEELQAFVD  266


> P25310 Lysozyme M1 [Streptomyces globisporus]
Length=294

 Score = 89.4 bits (220),  Expect = 3e-24
 Identities = 58/201 (29%), Positives = 95/201 (47%), Gaps = 11/201 (5%)

Query  56   VRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHF  115
            V+G DVSH QG+I+W+ +      F Y+KATEG +++D +F  N+  A       GAYHF
Sbjct  82   VQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHF  141

Query  116  YR-LCRDGKTQAENFIAT---VPKKIDALPPVIDLEYDANCINTY--TKEQLLEQIKVTH  169
             R     G  QA+ F +      +    LP V+D+E++ +    Y  +  Q+   I   H
Sbjct  142  ARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFH  201

Query  170  DLLKAHYGKQPIFYVSKNFYHIVL---MGSFQNAPLWIRDYD-GKPELKDD-RQWLFWQY  224
               KA   +  + Y + ++++       G    +P W+  +    P +      W FWQY
Sbjct  202  ARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQY  261

Query  225  TSKSSIKGIEKPVDLNVYAGS  245
            ++   + G+   VD N + GS
Sbjct  262  SATGRVGGVSGDVDRNKFNGS  282


> P26836 Probable autolytic lysozyme [Clostridium perfringens (strain 
13 / Type A)]
Length=342

 Score = 84.0 bits (206),  Expect = 3e-22
 Identities = 55/198 (28%), Positives = 95/198 (48%), Gaps = 5/198 (3%)

Query  48   MASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYH  107
            M       ++G DVS+ QGNI++  +  +  + VY+KATEG  F+D   ++N+ +A+   
Sbjct  1    MEGRNSNNLKGIDVSNWQGNINFKSVKNEGIEVVYIKATEGDYFKDSYAKQNYKRAKAEG  60

Query  108  FHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQIKV  167
              VG YHF++  ++ K QA+ FI  +  +I A      L  D       +  +L      
Sbjct  61   LKVGFYHFFKPNKNAKRQAKYFIDYL-NEIGATDYDCKLALDVETTEGRSAYELTTMCIE  119

Query  168  THDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRDYDGKPELKDDRQWLFW---QY  224
              + ++    ++ + Y   +F +  L       PLWI +Y G    KD+R W  W   QY
Sbjct  120  FLEEVRKITNREVVVYTYTSFANNNLDNRLGVYPLWIAEY-GVKAPKDNRVWSSWIGFQY  178

Query  225  TSKSSIKGIEKPVDLNVY  242
            + K ++ G+    D+N +
Sbjct  179  SDKGNVAGVSGNCDMNEF  196


> P34020 Autolytic lysozyme [Clostridium acetobutylicum (strain 
ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)]
Length=324

 Score = 74.3 bits (181),  Expect = 6e-19
 Identities = 50/189 (26%), Positives = 91/189 (48%), Gaps = 9/189 (5%)

Query  56   VRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHF  115
            ++G D+   QG++D+  +     + VY+KATEG  + D  +++ +  A+     +G YH+
Sbjct  1    MKGIDIYSGQGSVDFNAVKESGVEVVYIKATEGLTYTDSTYKDFYDGAKNAGLKIGFYHY  60

Query  116  YRLCRDGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQIKVTHDLLKAH  175
             R   D  ++AE+F  T+          ID+E         + +Q+   ++   D L  +
Sbjct  61   LR-ANDPTSEAEHFFNTISGLSLDCKCAIDVEVTLG----QSIDQISSNVRKFADYL-IN  114

Query  176  YGKQPIFYVSKNFYHIVLMGSFQNAPLWIRDYD-GKPELKDDRQWLFWQYTSKSSIKGIE  234
             G     Y   NFY   L  + ++ PLWI +Y   KP +  D  ++ +QY+   S+ GI 
Sbjct  115  KGLDVCVYTYTNFYKDNLNSTVKDLPLWIAEYGVSKPNI--DASYVGFQYSDSGSVNGIS  172

Query  235  KPVDLNVYA  243
               DL+ ++
Sbjct  173  GSADLDEFS  181


> D4ANU4 N,O-diacetylmuramidase [Arthroderma benhamiae (strain 
ATCC MYA-4681 / CBS 112371)]
Length=235

 Score = 59.3 bits (142),  Expect = 5e-14
 Identities = 41/140 (29%), Positives = 64/140 (46%), Gaps = 5/140 (4%)

Query  55   TVRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYH  114
            +V+GFD+S +Q N+D+        +FV +KATEG  F+   F   +  A    F  G YH
Sbjct  29   SVQGFDISGYQPNVDFRAAYNGGARFVMIKATEGTTFKSSTFNSQYTGATNNKFIRGGYH  88

Query  115  FYRLCRDGKTQAENFIATVPKKID---ALPPVIDLEYDANCINTY--TKEQLLEQIKVTH  169
            F         Q + F+A      +    LP +IDLE  +     Y  +   ++  IK   
Sbjct  89   FAHPDTSATAQCDYFLANGGGWSNDGITLPGMIDLEGTSGKPKCYGLSASAMIAWIKAFS  148

Query  170  DLLKAHYGKQPIFYVSKNFY  189
            D   A  G+ P+ Y S +++
Sbjct  149  DRYNAKTGRYPMIYTSPDWW  168


> P00721 N,O-diacetylmuramidase [Chalaropsis sp]
Length=211

 Score = 51.2 bits (121),  Expect = 3e-11
 Identities = 41/144 (28%), Positives = 69/144 (48%), Gaps = 9/144 (6%)

Query  55   TVRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENW---LKAREYHFHVG  111
            TV+GFD+S +Q ++++A       +FV +KATEG  + +P F   +     A   +F  G
Sbjct  1    TVQGFDISSYQPSVNFAGAYSAGARFVIIKATEGTSYTNPSFSSQYNGATTATGNYFIRG  60

Query  112  AYHFYRLCR-DGKTQAENFIATVPKKID---ALPPVIDLEYDANCINTY--TKEQLLEQI  165
             YHF       G  QA+ FIA           LP ++DLE + +    +  +   ++  I
Sbjct  61   GYHFAHPGETTGAAQADYFIAHGGGWSGDGITLPGMLDLESEGSNPACWGLSAASMVAWI  120

Query  166  KVTHDLLKAHYGKQPIFYVSKNFY  189
            K   D   A  G+ P+ Y + +++
Sbjct  121  KAFSDRYHAVTGRYPMLYTNPSWW  144


> O35604 NPC intracellular cholesterol transporter 1 [Mus musculus]
Length=1277

 Score = 38.9 bits (89),  Expect = 8e-07
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 5/58 (9%)

Query  74   SPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVG---AYHFYRLCRDGKTQAEN  128
            SP + QF+ + ATE  D+ DPK QEN    +E  + VG   A   Y  CRD +  + N
Sbjct  114  SPHQSQFLNVTATE--DYFDPKTQENKTNVKELEYFVGQSFANAMYNACRDVEAPSSN  169



Lambda      K        H        a         alpha
   0.326    0.141    0.448    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 695983


  Database: 75142a90ded6a066609a385042b78e4d.SwissProt.fasta
    Posted date:  Sep 28, 2020  1:11 PM
  Number of letters in database: 3,499
  Number of sequences in database:  9



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40