ACIAD0199 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 1d96ae568c50a2a30df1f2bd121a5b56.TrEMBL.fasta
           21 sequences; 6,369 total letters



Query= ACIAD0199

Length=217
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FFI8 Rieske domain-containing protein [Acinetobacter baylyi (...   455    2e-167
  N9S4Q2 Rieske domain-containing protein [Acinetobacter ursingii...   201    2e-67 
  A0A009YZZ4 Rieske domain protein [Acinetobacter sp. 479375]          201    2e-67 
  N9DDQ3 Rieske domain-containing protein [Acinetobacter ursingii...   199    9e-67 
  A0A1Z9Z3Y5 Rieske domain-containing protein [Acinetobacter populi]   197    1e-65 
  A0A2N0WE16 Nitrite reductase [Acinetobacter proteolyticus]           191    2e-63 
  A0A1E7QY87 Nitrite reductase [Acinetobacter proteolyticus]           191    3e-63 
  A0A240EDU7 Rieske [2Fe-2S] domain-containing protein [Acinetoba...   188    2e-62 
  N8QLZ9 Rieske domain-containing protein [Acinetobacter sp. NIPH...   188    3e-62 
  S3TI23 Rieske domain-containing protein [Acinetobacter colistin...   186    1e-61 
  N9N5K1 Rieske domain-containing protein [Acinetobacter sp. CIP ...   186    1e-61 
  Q8RTJ0 LppA [Pseudoalteromonas tunicata D2]                         79.3    1e-20 
  B6D1N2 Aromatic ring-hydroxylating dioxygenase subunit alpha [K...  76.3    1e-19 
  A0A120HY12 Rieske [2Fe-2S] iron-sulfur domain-containing protei...  77.0    2e-19 
  G1K3V2 McpG [Streptomyces longispororuber]                          70.5    1e-17 
  Q2KQ79 IvaA [Comamonas testosteroni]                                70.5    2e-17 
  A0A1C9CJL7 MdeA [Hydrogenophaga intermedia]                         67.4    2e-16 
  E5BBJ2 4-aminobenzenesulfonate 3,4-dioxygenase [Hydrogenophaga ...  67.8    2e-16 
  O24847 Rieske domain-containing protein [Acinetobacter baylyi (...  64.7    1e-15 
  F7J184 Neverland [Xenopus laevis]                                   65.1    1e-15 
  G3KEB2 Tert-butyl alcohol monooxygenase [Methylibium sp. R8]        64.7    2e-15 


> Q6FFI8 Rieske domain-containing protein [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=216

 Score =  455 bits (1171),  Expect = 2e-167
 Identities = 216/216 (100%), Positives = 216/216 (100%), Gaps = 0/216 (0%)

Query  1    MIQQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHG  60
            MIQQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHG
Sbjct  1    MIQQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHG  60

Query  61   ESLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSL  120
            ESLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSL
Sbjct  61   ESLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSL  120

Query  121  DMPQSSSYHHYAGSVHLQGDLTDIQQVLSAWGTQIAPWQWQLTQADLDAMLWLTPIQQDQ  180
            DMPQSSSYHHYAGSVHLQGDLTDIQQVLSAWGTQIAPWQWQLTQADLDAMLWLTPIQQDQ
Sbjct  121  DMPQSSSYHHYAGSVHLQGDLTDIQQVLSAWGTQIAPWQWQLTQADLDAMLWLTPIQQDQ  180

Query  181  AMLHMMKHSSHSLADAFHRLQKIRDQIENKQEISYV  216
            AMLHMMKHSSHSLADAFHRLQKIRDQIENKQEISYV
Sbjct  181  AMLHMMKHSSHSLADAFHRLQKIRDQIENKQEISYV  216


> N9S4Q2 Rieske domain-containing protein [Acinetobacter ursingii 
NIPH 706]
Length=218

 Score =  201 bits (512),  Expect = 2e-67
 Identities = 105/217 (48%), Positives = 133/217 (61%), Gaps = 7/217 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PSVL+E  EV Q  V+D +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSVLIEAGEVEQFLVEDKDVAVWRSMQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P +LC+ +YAV E  GMIW+GG +  +   D+P
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPDQRAPKSLCAKSYAVTEKSGMIWYGGDA--DYCADLP  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQVLSAWGTQIAPWQ----WQLTQADLDAMLWLTPIQQD  179
                   YAGSV L   L+ +Q  LS  G           WQ    D    ++LTP Q +
Sbjct  123  LEEVPFVYAGSVTLSTTLSQVQDYLSELGVSDCVSHNRLVWQGHAKDSALRIYLTPTQSN  182

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQEISYV  216
               +H M             L ++R  +E +Q +SYV
Sbjct  183  VVTIHTMLLQEEHATQRHPLLNQMRQDLELEQ-LSYV  218


> A0A009YZZ4 Rieske domain protein [Acinetobacter sp. 479375]
Length=218

 Score =  201 bits (512),  Expect = 2e-67
 Identities = 105/217 (48%), Positives = 133/217 (61%), Gaps = 7/217 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PSVL+E  EV Q  V+D +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSVLIEAGEVEQFLVEDKDVAVWRSMQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P +LC+ +YAV E  GMIW+GG +  +   D+P
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPDQRAPKSLCAKSYAVTEKSGMIWYGGDA--DYCADLP  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQVLSAWGTQIAPWQ----WQLTQADLDAMLWLTPIQQD  179
                   YAGSV L   L+ +Q  LS  G           WQ    D    ++LTP Q +
Sbjct  123  LEEVPFVYAGSVTLSTTLSQVQDYLSELGVSDCVSHNRLVWQGHAKDSALRIYLTPTQSN  182

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQEISYV  216
               +H M             L ++R  +E +Q +SYV
Sbjct  183  VVTIHTMLLQEEHATQRHPLLNQMRQDLELEQ-LSYV  218


> N9DDQ3 Rieske domain-containing protein [Acinetobacter ursingii 
ANC 3649]
Length=218

 Score =  199 bits (507),  Expect = 9e-67
 Identities = 105/217 (48%), Positives = 132/217 (61%), Gaps = 7/217 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PSVL+E  EV Q  V+D +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSVLIEAGEVEQFLVEDKDVAVWRSIQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P +LC+ +YAV E  GMIW+GG +  +   D+P
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPDQRAPKSLCAKSYAVTEKSGMIWYGGDA--DCCADLP  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQVLSAWGTQIAPWQ----WQLTQADLDAMLWLTPIQQD  179
                   YAGSV L   L  +Q  LS  G           WQ    D    ++LTP Q +
Sbjct  123  LEEVPFVYAGSVTLSTTLPQVQDYLSELGISDCVSHNRLVWQGHAKDSALRIYLTPTQSN  182

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQEISYV  216
               +H M             L ++R  +E +Q +SYV
Sbjct  183  VVTIHAMLLQEEHATQRHPLLNQMRQDLEMEQ-LSYV  218


> A0A1Z9Z3Y5 Rieske domain-containing protein [Acinetobacter populi]
Length=222

 Score =  197 bits (500),  Expect = 1e-65
 Identities = 97/217 (45%), Positives = 136/217 (63%), Gaps = 6/217 (3%)

Query  1    MIQQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHG  60
            M  QW+PILPS LL+  EV++  +   EVV+WRS  G VQIWENRCPHRSVRLSLG V G
Sbjct  2    MSVQWLPILPSELLQNTEVLKVLINGKEVVVWRSALGHVQIWENRCPHRSVRLSLGHVDG  61

Query  61   ESLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSL  120
            E+L+CAYHGW+F+A  G CQ+IPAQP QR P ++CS  Y V+E++GMIWFGG  HE +  
Sbjct  62   ENLVCAYHGWEFAAQDGSCQKIPAQPEQRAPKSVCSKAYPVSENNGMIWFGGFDHELKPE  121

Query  121  DMPQSSSYH-----HYAGSVHLQGDLTDIQQVLS-AWGTQIAPWQWQLTQADLDAMLWLT  174
             + Q + +      HYAGSV +   + ++ + L      Q++P+ +       D  L +T
Sbjct  122  PLSQQTLFPKITPVHYAGSVLIHCAIDEVSEFLQHLHFRQVSPYCFLGDDEFADVQLIIT  181

Query  175  PIQQDQAMLHMMKHSSHSLADAFHRLQKIRDQIENKQ  211
            P   ++  LH ++  + S+  +   L +IR Q+E  Q
Sbjct  182  PTDTEKTTLHALQPQAESVQRSLDSLFQIRQQLEEHQ  218


> A0A2N0WE16 Nitrite reductase [Acinetobacter proteolyticus]
Length=218

 Score =  191 bits (485),  Expect = 2e-63
 Identities = 98/212 (46%), Positives = 137/212 (65%), Gaps = 6/212 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PS+L+E  EV Q  V+D +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSILIETGEVEQVLVRDKDVAVWRSMQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P ++C+ +YAV E+ G+IW+G  +  +  +D  
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPEQRAPKSVCARSYAVMENSGLIWYGEDALPD--IDPL  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQVLSAWG-TQIA---PWQWQLTQADLDAMLWLTPIQQD  179
                   YAGSV +   L+ +Q  L A G T+ A      W+   AD    ++LTP Q +
Sbjct  123  FEEIQLVYAGSVTISVTLSQVQDYLLAAGLTECAMHNGLSWRDDAADRTLRIYLTPTQTN  182

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQ  211
               +H M   S     +   L+++R+ +E+++
Sbjct  183  VVTVHAMLLQSAKPTQSHPLLKQMRENLESEK  214


> A0A1E7QY87 Nitrite reductase [Acinetobacter proteolyticus]
Length=218

 Score =  191 bits (484),  Expect = 3e-63
 Identities = 98/212 (46%), Positives = 136/212 (64%), Gaps = 6/212 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PS+L+E  EV Q  V+D +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSILIETGEVEQVLVRDKDVAVWRSMQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P ++C+ +YAV E+ G+IW+G  +  +  +D  
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPEQRAPKSVCARSYAVMENSGLIWYGEDALPD--IDPL  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQVLSAWG-TQIA---PWQWQLTQADLDAMLWLTPIQQD  179
                   YAGSV +   L+ +Q  L A G T+ A      W+   AD    ++LTP Q +
Sbjct  123  FEEIQLVYAGSVTISVTLSQVQDYLLAAGLTECAMHNGLSWRDDAADRTLRIYLTPTQTN  182

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQ  211
               +H M   S         L+++R+ +E+++
Sbjct  183  VVTVHAMLLQSAKPTQCHPLLKQMRENLESEK  214


> A0A240EDU7 Rieske [2Fe-2S] domain-containing protein [Acinetobacter 
puyangensis]
Length=221

 Score =  188 bits (478),  Expect = 2e-62
 Identities = 97/217 (45%), Positives = 132/217 (61%), Gaps = 6/217 (3%)

Query  1    MIQQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHG  60
            M  QW+PILPS LL+  EV++  +   EVV+WRS  G VQIWENRCPHRSVRLSLG V G
Sbjct  1    MSVQWLPILPSELLQNAEVLKVLINGKEVVVWRSVSGHVQIWENRCPHRSVRLSLGHVDG  60

Query  61   ESLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSL  120
            E+L+CAYHGW+F+A  G CQ+IPAQP QR P ++CS  Y V+E++GMIWFGG   E +  
Sbjct  61   ENLVCAYHGWEFAAQDGSCQKIPAQPEQRAPKSVCSKAYPVSENNGMIWFGGFDLELRPE  120

Query  121  DMPQSSSY-----HHYAGSVHLQGDLTDIQQVLS-AWGTQIAPWQWQLTQADLDAMLWLT  174
             + Q          HYAGSV +   + ++ + L      Q +P  +       D  L+LT
Sbjct  121  PLAQQILSLKIIPVHYAGSVLIHCTMDEVTEFLQHLHFRQTSPCGFLGDDDFADVQLFLT  180

Query  175  PIQQDQAMLHMMKHSSHSLADAFHRLQKIRDQIENKQ  211
            P   ++  LH ++  + ++  +   L +IR QIE  Q
Sbjct  181  PTDAEKTTLHALQPQAETVQRSLDSLFQIRQQIEEHQ  217


> N8QLZ9 Rieske domain-containing protein [Acinetobacter sp. NIPH 
809]
Length=217

 Score =  188 bits (477),  Expect = 3e-62
 Identities = 98/212 (46%), Positives = 136/212 (64%), Gaps = 7/212 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PS+L+E  EV Q  V+D +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSILIETGEVEQVLVRDKDVAVWRSMQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P ++C+ +YAV E+ G+IW+G  +  +  +D  
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPEQRAPKSVCARSYAVMENSGLIWYGEDALPD--IDPL  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQVLSAWG-TQIA---PWQWQLTQADLDAMLWLTPIQQD  179
                   YAGSV +   L+ +Q  L A G T+ A      W+   AD    ++LTP Q +
Sbjct  123  FEEIQLVYAGSVTISVTLSQVQDYLLAAGLTECAMHNGLSWR-DDADRTLRIYLTPTQTN  181

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQ  211
               +H M   S         L+++R+ +E+++
Sbjct  182  VVTVHAMLLQSAKPTQCHPLLKQMRENLESEK  213


> S3TI23 Rieske domain-containing protein [Acinetobacter colistiniresistens]
Length=218

 Score =  186 bits (473),  Expect = 1e-61
 Identities = 96/212 (45%), Positives = 135/212 (64%), Gaps = 6/212 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PS+L+E  EV Q  V+  +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSILIETGEVEQVLVRGKDVAVWRSMQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P ++C+ +YAV E+ G+IW+G  +  +  +D  
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPEQRAPKSVCARSYAVMENSGLIWYGEDALPD--IDPL  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQ-VLSAWGTQIA---PWQWQLTQADLDAMLWLTPIQQD  179
                   YAGSV +   L  +Q  +L A  T+ A      W+   AD    ++LTP Q +
Sbjct  123  FEEIQLVYAGSVTISVTLPQVQDYLLEAGLTECAMHNGLSWRDDAADRRLRIYLTPTQTN  182

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQ  211
               +H M   S      +  L+++R+ +E+++
Sbjct  183  VVTVHAMLLQSAKPTQCYPLLRQMRENLESEK  214


> N9N5K1 Rieske domain-containing protein [Acinetobacter sp. CIP 
64.2]
Length=218

 Score =  186 bits (473),  Expect = 1e-61
 Identities = 96/212 (45%), Positives = 135/212 (64%), Gaps = 6/212 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QWIP++PS+L+E  EV Q  V+  +V +WRS QG VQIWENRCPHRSVRLSLG+V GESL
Sbjct  5    QWIPLVPSILIETGEVEQVLVRGKDVAVWRSMQGHVQIWENRCPHRSVRLSLGQVQGESL  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGHSHENQSLDMP  123
            +CAYHGWQF+A+ G CQRIPAQP QR P ++C+ +YAV E+ G+IW+G  +  +  +D  
Sbjct  65   VCAYHGWQFAAEDGHCQRIPAQPEQRAPKSVCARSYAVMENSGLIWYGEDALPD--IDPL  122

Query  124  QSSSYHHYAGSVHLQGDLTDIQQ-VLSAWGTQIA---PWQWQLTQADLDAMLWLTPIQQD  179
                   YAGSV +   L  +Q  +L A  T+ A      W+   AD    ++LTP Q +
Sbjct  123  FEEIQLVYAGSVTISVTLPQVQDYLLEAGLTECAMHNGLSWRDDAADRRLRIYLTPTQTN  182

Query  180  QAMLHMMKHSSHSLADAFHRLQKIRDQIENKQ  211
               +H M   S      +  L+++R+ +E+++
Sbjct  183  VVTVHAMLLQSAKPTQCYPLLRQMRENLESEK  214


> Q8RTJ0 LppA [Pseudoalteromonas tunicata D2]
Length=370

 Score = 79.3 bits (194),  Expect = 1e-20
 Identities = 45/139 (32%), Positives = 72/139 (52%), Gaps = 5/139 (4%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QW  IL +  ++ K V    ++ + +V++R   G +   ++RCPH+ V+LSLG+ HG+ +
Sbjct  5    QWYAILRTQDVKKKPVGIKRLEKL-LVLYRDTAGELVCLDDRCPHKGVKLSLGQQHGDLI  63

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQ-RVPSTLCSTTYAVAEHDGMI--WFGGHSHENQSL  120
             C YHG+Q+    G C  +P    +  VP  +C  +Y V E  G+I  WFG    E++  
Sbjct  64   ACPYHGFQYD-QQGDCVHMPVLGQKGNVPKGMCVKSYKVKEELGLIWFWFGDVRQEHEYP  122

Query  121  DMPQSSSYHHYAGSVHLQG  139
            D+P       Y G     G
Sbjct  123  DIPMFKQLKEYKGHYSYYG  141


> B6D1N2 Aromatic ring-hydroxylating dioxygenase subunit alpha 
[Klebsiella pneumoniae]
Length=345

 Score = 76.3 bits (186),  Expect = 1e-19
 Identities = 38/90 (42%), Positives = 59/90 (66%), Gaps = 2/90 (2%)

Query  20   IQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESLICAYHGWQFSADHGQC  79
            ++A + D ++VI+R + G+V +  + CPHR V L+LG    E ++C YHG +F  D G+C
Sbjct  40   VKATLLDEQLVIYRIK-GQVVVARDVCPHRGVPLTLGFHEEEGIVCPYHGLRFGED-GRC  97

Query  80   QRIPAQPTQRVPSTLCSTTYAVAEHDGMIW  109
             RIP+ P Q +P+ L  T++AV E  G+IW
Sbjct  98   NRIPSSPGQPIPAKLHLTSFAVEERYGLIW  127


> A0A120HY12 Rieske [2Fe-2S] iron-sulfur domain-containing protein 
[Nostoc sp. CAVN2]
Length=502

 Score = 77.0 bits (188),  Expect = 2e-19
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 8/114 (7%)

Query  3    QQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGE-  61
            +QW PI     L+P       +     V+WR +QG+   +E+ CPHR VRLS G +  + 
Sbjct  29   KQWYPIAVVECLDPSRPQPVELLGKNFVLWRDKQGKWNCFEDLCPHRLVRLSEGRIESDG  88

Query  62   SLICAYHGWQFSADHGQCQRIP------AQPTQRVPSTLCSTTYAVAEHDGMIW  109
            +L+CAYH W+F+++ G+C  +P      ++      S  C+T Y + E  G++W
Sbjct  89   TLLCAYHAWRFNSE-GKCVSMPQSKDKESEAQNCASSRSCATVYPLQERQGLLW  141


> G1K3V2 McpG [Streptomyces longispororuber]
Length=347

 Score = 70.5 bits (171),  Expect = 1e-17
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 4/129 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QW PIL +  ++            E+V+WR   G +     RCPH+   L+ G + G S+
Sbjct  5    QWYPILRTDDIKRDAPTGVRRMGEELVLWRDLDGNLVCQSARCPHKGANLADGRLVGNSV  64

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQ-RVPSTLCSTTYAVAEHDGMI--WFGGHSHENQSL  120
             C YHG++F  D G C+ +PA  ++ RVP++L   TY V E   ++  W+G        +
Sbjct  65   ACPYHGFRFGTD-GACRLVPALGSEGRVPASLRVDTYEVREKYDLVWLWWGDKRANLPEI  123

Query  121  DMPQSSSYH  129
            ++P   + H
Sbjct  124  ELPHELAEH  132


 Score = 20.4 bits (41),  Expect = 0.66
 Identities = 10/35 (29%), Positives = 18/35 (51%), Gaps = 2/35 (6%)

Query  156  APWQWQLTQADLDAMLWLTPIQQ--DQAMLHMMKH  188
            AP    + Q  L+   WL PI +   QA++ + ++
Sbjct  234  APSMTHVKQGLLEVTTWLVPIDEHHTQAIMRLYEY  268


> Q2KQ79 IvaA [Comamonas testosteroni]
Length=359

 Score = 70.5 bits (171),  Expect = 2e-17
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 3/81 (4%)

Query  29   VVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESLICAYHGWQFSADHGQCQRIPAQPTQ  88
            VV++R+E GRV   E+RC HR + LS G V    L C YHG  FS + GQC  IP Q  +
Sbjct  43   VVLFRTEDGRVAALEDRCCHRELPLSCGTVEAAGLRCGYHGLLFSHE-GQCLEIPGQ--E  99

Query  89   RVPSTLCSTTYAVAEHDGMIW  109
            R+P+  C  ++ + E D ++W
Sbjct  100  RIPTKACVKSFELRERDQILW  120


 Score = 18.5 bits (36),  Expect = 2.7
 Identities = 7/22 (32%), Positives = 8/22 (36%), Gaps = 0/22 (0%)

Query  108  IWFGGHSHENQSLDMPQSSSYH  129
            IW G        LD P    +H
Sbjct  241  IWTGAMDAGQDRLDNPAREGFH  262


> A0A1C9CJL7 MdeA [Hydrogenophaga intermedia]
Length=347

 Score = 67.4 bits (163),  Expect = 2e-16
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 3/81 (4%)

Query  29   VVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESLICAYHGWQFSADHGQCQRIPAQPTQ  88
            V+++R  QGRV   ENRC HRS  L +G   G+ + C YHG +F+   G C  IP Q  +
Sbjct  31   VLLYRDTQGRVVALENRCCHRSAPLHIGRQEGDCVRCLYHGLKFNPS-GACVEIPGQ--E  87

Query  89   RVPSTLCSTTYAVAEHDGMIW  109
            ++P   C  +Y V E + ++W
Sbjct  88   QIPPKTCIKSYPVVERNRLVW  108


> E5BBJ2 4-aminobenzenesulfonate 3,4-dioxygenase [Hydrogenophaga 
sp. PBC]
Length=457

 Score = 67.8 bits (164),  Expect = 2e-16
 Identities = 36/118 (31%), Positives = 66/118 (56%), Gaps = 13/118 (11%)

Query  1    MIQQWIPIL-PSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVH  59
            ++ ++ P + P++ + P + ++   Q+   V++++ +GR  + +  CPHR   L+ G   
Sbjct  31   LVDEFDPAIDPAMAVRPVKPVRVLGQNF--VLFKNSEGRFGLLDRDCPHRGADLAFGRNE  88

Query  60   GESLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCS----TTYAVAEHDGMI--WFG  111
            G+ L C +HGW+F  D G+C   PA+P     STLC+     +Y + E  G++  WFG
Sbjct  89   GDGLRCPFHGWKFDVD-GRCLETPAEP---AGSTLCNRVTQKSYPLIERSGVLFGWFG  142


> O24847 Rieske domain-containing protein [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=316

 Score = 64.7 bits (156),  Expect = 1e-15
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 3/115 (3%)

Query  4    QWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            QW P+L S  +    V    + +  +V+WR E G++   E+RCPHR  RLSLG   G+ +
Sbjct  25   QWYPVLASWEVSANPVGITRLGE-NIVVWRDEAGQLYALEDRCPHRGARLSLGWNLGDRV  83

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAE-HDGM-IWFGGHSHE  116
             C YHG +          +PA     +    C  +Y + E HD + IWFG  ++E
Sbjct  84   ACWYHGVRSGGRMVLVADVPAVHECPLKGAACVKSYPIIEKHDAIFIWFGIDANE  138


> F7J184 Neverland [Xenopus laevis]
Length=454

 Score = 65.1 bits (157),  Expect = 1e-15
 Identities = 35/110 (32%), Positives = 58/110 (53%), Gaps = 3/110 (3%)

Query  5    WIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLG-EVHGESL  63
            W   L S LL P  V    +   ++ ++R+ +G+V + +  CPH    L++G +V G+ +
Sbjct  117  WYRALDSHLLPPGTVQDCTLLGEQLAVYRTLEGKVYVVDAYCPHLGANLAVGGKVVGDCI  176

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIWFGGH  113
             C +HGWQF  + G+C RIP    ++VP      T    E +GM++   H
Sbjct  177  ECPFHGWQFRGEDGKCTRIPY--AEKVPDFAKIKTRPSCELNGMVFVWYH  224


> G3KEB2 Tert-butyl alcohol monooxygenase [Methylibium sp. R8]
Length=470

 Score = 64.7 bits (156),  Expect = 2e-15
 Identities = 35/111 (32%), Positives = 54/111 (49%), Gaps = 5/111 (5%)

Query  1    MIQQWIPI-LPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVH  59
            M + W P+ L   L +  + I+   +D+  V +R  QG V +   +C HR   L  G V 
Sbjct  47   MRRYWQPVCLSQELTDVPKAIRILHEDL--VAFRDRQGNVGVLHRKCAHRGASLEFGIVQ  104

Query  60   GESLICAYHGWQFSADHGQCQRIPAQPTQ-RVPSTLCSTTYAVAEHDGMIW  109
               + C YHGW F  D G+    PA+P   ++  T+C   Y   E DG+++
Sbjct  105  ERGIRCCYHGWHFDVD-GKLLEAPAEPPDTKLKETVCQGAYPAFERDGLVF  154


 Score = 16.9 bits (32),  Expect = 8.7
 Identities = 7/35 (20%), Positives = 14/35 (40%), Gaps = 0/35 (0%)

Query  176  IQQDQAMLHMMKHSSHSLADAFHRLQKIRDQIENK  210
            + Q    +H ++H   S    +     +RD +  K
Sbjct  357  VSQGPIAVHGLEHPGRSDVGVYMCRSLLRDAVAGK  391



Lambda      K        H        a         alpha
   0.323    0.133    0.438    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 932928


  Database: 1d96ae568c50a2a30df1f2bd121a5b56.TrEMBL.fasta
    Posted date:  Sep 21, 2020  4:21 AM
  Number of letters in database: 6,369
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40