ACIAD0199 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 9b523ca0a415c8c1dcadcfe7f20d39ab.SwissProt.fasta
           10 sequences; 4,696 total letters



Query= ACIAD0199

Length=217
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  H9N291 Oxidoreductase NdmD [Pseudomonas putida]                     94.4    2e-25
  Q9SK50 Protein TIC 55, chloroplastic [Arabidopsis thaliana]         80.5    9e-21
  O49931 Protein TIC 55, chloroplastic [Pisum sativum]                77.8    8e-20
  Q44256 3-chlorobenzoate-3,4-dioxygenase oxygenase subunit [Coma...  72.4    3e-18
  P94679 Toluene-4-sulfonate monooxygenase system iron-sulfur sub...  67.4    1e-16
  H9N289 Methylxanthine N1-demethylase NdmA [Pseudomonas putida]      67.0    2e-16
  O05616 Vanillate O-demethylase oxygenase subunit [Pseudomonas s...  63.9    2e-15
  Q9AHG3 Putative toluene-4-sulfonate monooxygenase system iron-s...  63.5    3e-15
  Q9ZWM5 Chlorophyllide a oxygenase, chloroplastic [Chlamydomonas...  60.1    5e-14
  Q8S7E1 Chlorophyllide a oxygenase, chloroplastic [Oryza sativa ...  59.7    7e-14


> H9N291 Oxidoreductase NdmD [Pseudomonas putida]
Length=588

 Score = 94.4 bits (233),  Expect = 2e-25
 Identities = 43/108 (40%), Positives = 56/108 (52%), Gaps = 0/108 (0%)

Query  2    IQQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGE  61
            + QW PI  +  L  + V  A +   E+ IWR + G V  WENRCPHR +RL+LG   G 
Sbjct  6    VNQWFPIATTEDLPKRHVFHATLLGQEMAIWRDDSGSVNAWENRCPHRGLRLTLGANTGN  65

Query  62   SLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIW  109
             L C YHGW + +  G C  +PA      P+     T+ V E  G IW
Sbjct  66   ELRCQYHGWTYESGTGGCTFVPAHRDAPPPNAARVNTFPVREKHGFIW  113


> Q9SK50 Protein TIC 55, chloroplastic [Arabidopsis thaliana]
Length=539

 Score = 80.5 bits (197),  Expect = 9e-21
 Identities = 35/108 (32%), Positives = 63/108 (58%), Gaps = 2/108 (2%)

Query  3    QQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGES  62
            ++W P+  +  +     +   V D ++V+++  +G ++ +E+RCPHR  +LS G++    
Sbjct  86   EEWYPLYLTKNVPEDAPLGLTVYDRQIVLYKDGEGTLRCYEDRCPHRLAKLSEGQLIDGR  145

Query  63   LICAYHGWQFSADHGQCQRIPAQP-TQRVPSTLCSTTYAVAEHDGMIW  109
            L C YHGWQF  + G+C +IP  P + ++P   C  TY V +  G++W
Sbjct  146  LECLYHGWQFEGE-GKCVKIPQLPASAKIPKAACVKTYEVKDSQGVVW  192


 Score = 18.1 bits (35),  Expect = 2.8
 Identities = 14/37 (38%), Positives = 18/37 (49%), Gaps = 6/37 (16%)

Query  6    IPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIW  42
            IP LP+    PK    A V+  EV   +  QG V +W
Sbjct  164  IPQLPASAKIPKA---ACVKTYEV---KDSQGVVWVW  194


> O49931 Protein TIC 55, chloroplastic [Pisum sativum]
Length=553

 Score = 77.8 bits (190),  Expect = 8e-20
 Identities = 36/108 (33%), Positives = 60/108 (56%), Gaps = 2/108 (2%)

Query  3    QQWIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGES  62
            ++W P+  +  +     +   V D  +V++R    + Q +E+RCPHR  +LS G++    
Sbjct  101  EEWYPLYLTKNVPHDAPLGLKVYDKNIVLFRDGNDQFQCYEDRCPHRLAKLSEGQLIDGR  160

Query  63   LICAYHGWQFSADHGQCQRIPAQPTQ-RVPSTLCSTTYAVAEHDGMIW  109
            L C YHGWQF  + G+C +IP  P   ++P + C  TY V +  G++W
Sbjct  161  LECLYHGWQFEGE-GKCVKIPQLPADAKIPKSACVKTYEVRDSQGVLW  207


 Score = 19.6 bits (39),  Expect = 0.90
 Identities = 15/40 (38%), Positives = 20/40 (50%), Gaps = 6/40 (15%)

Query  6    IPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENR  45
            IP LP+    PK    A V+  EV   R  QG + +W +R
Sbjct  179  IPQLPADAKIPKS---ACVKTYEV---RDSQGVLWVWMSR  212


> Q44256 3-chlorobenzoate-3,4-dioxygenase oxygenase subunit [Comamonas 
testosteroni]
Length=432

 Score = 72.4 bits (176),  Expect = 3e-18
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 3/111 (3%)

Query  1    MIQQWIPILPSVLLEPK-EVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVH  59
            M + WIP L S  LE     ++  +   ++V +R   G V + ++RCPHR V L +G V 
Sbjct  23   MREYWIPALKSTELEAGGSPVRLLLLGEKLVAFREPSGAVGVMDSRCPHRGVSLFMGRVE  82

Query  60   GESLICAYHGWQFSADHGQCQRIPA-QPTQRVPSTLCSTTYAVAEHDGMIW  109
               L C YHGW+FSA+ G+C  +P+ +P     +++    Y V E  G++W
Sbjct  83   EGGLRCVYHGWKFSAE-GKCVDMPSVRPEDEFKNSVRVARYPVKEMAGVVW  132


 Score = 16.5 bits (31),  Expect = 8.4
 Identities = 8/24 (33%), Positives = 11/24 (46%), Gaps = 0/24 (0%)

Query  103  EHDGMIWFGGHSHENQSLDMPQSS  126
            EH  M +F     + + LD P  S
Sbjct  267  EHTMMFFFRWTGSKAKRLDTPLKS  290


> P94679 Toluene-4-sulfonate monooxygenase system iron-sulfur subunit 
TsaM1 [Comamonas testosteroni]
Length=347

 Score = 67.4 bits (163),  Expect = 1e-16
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 3/81 (4%)

Query  29   VVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESLICAYHGWQFSADHGQCQRIPAQPTQ  88
            V+++R  QGRV   ENRC HRS  L +G   G+ + C YHG +F+   G C  IP Q  +
Sbjct  31   VLLYRDTQGRVVALENRCCHRSAPLHIGRQEGDCVRCLYHGLKFNPS-GACVEIPGQ--E  87

Query  89   RVPSTLCSTTYAVAEHDGMIW  109
            ++P   C  +Y V E + ++W
Sbjct  88   QIPPKTCIKSYPVVERNRLVW  108


> H9N289 Methylxanthine N1-demethylase NdmA [Pseudomonas putida]
Length=351

 Score = 67.0 bits (162),  Expect = 2e-16
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 1/66 (2%)

Query  44   NRCPHRSVRLSLGEVHGESLICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAE  103
            +RC HRS +LSLG V G  L C YHGWQ+   HG CQ +PA P   +P+      +   E
Sbjct  60   DRCAHRSAKLSLGTVSGNRLQCPYHGWQYDT-HGACQLVPACPNSPIPNKAKVDRFDCEE  118

Query  104  HDGMIW  109
              G+IW
Sbjct  119  RYGLIW  124


> O05616 Vanillate O-demethylase oxygenase subunit [Pseudomonas 
sp. (strain HR199 / DSM 7063)]
Length=354

 Score = 63.9 bits (154),  Expect = 2e-15
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 4/82 (5%)

Query  28   EVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESLICAYHGWQFSADHGQCQRIPAQPT  87
            ++V +R  +GRV   E+ CPHR   LSLG V    LIC YHG +   +     +  A P 
Sbjct  29   KIVFYRGPEGRVAAVEDFCPHRGAPLSLGFVRDGKLICGYHGLEMGCE----GKTLAMPG  84

Query  88   QRVPSTLCSTTYAVAEHDGMIW  109
            QRV    C  +YAV E  G IW
Sbjct  85   QRVQGFPCIKSYAVEERYGFIW  106


> Q9AHG3 Putative toluene-4-sulfonate monooxygenase system iron-sulfur 
subunit TsaM2 [Comamonas testosteroni]
Length=346

 Score = 63.5 bits (153),  Expect = 3e-15
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 4/93 (4%)

Query  17   KEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESLICAYHGWQFSADH  76
            K + + F+ + +VV++R+  G     E+RC HR   LSLG+V    + C YHG  F+A  
Sbjct  19   KPLARTFLNE-KVVLFRTHDGHAVALEDRCCHRLAPLSLGDVEDAGIRCRYHGMVFNAS-  76

Query  77   GQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIW  109
            G C  IP Q  +++P  +C   + + E  G++W
Sbjct  77   GACVEIPGQ--EQIPPGMCVRRFPLVERHGLLW  107


> Q9ZWM5 Chlorophyllide a oxygenase, chloroplastic [Chlamydomonas 
reinhardtii]
Length=645

 Score = 60.1 bits (144),  Expect = 5e-14
 Identities = 38/106 (36%), Positives = 54/106 (51%), Gaps = 6/106 (6%)

Query  5    WIPILPSVLLEPKEVIQAFVQDIEV-VIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESL  63
            W P   S  L PK+ +  F    E  V++R E+G+     + C HR   LSLG+V    +
Sbjct  305  WYPAEFSARL-PKDTLVPFELFGEPWVMFRDEKGQPSCIRDECAHRGCPLSLGKVVEGQV  363

Query  64   ICAYHGWQFSADHGQCQRIPAQPTQRVPSTLCSTTYAVAEHDGMIW  109
            +C YHGW+F+ D G C ++P+ P  R    +       AE DG IW
Sbjct  364  MCPYHGWEFNGD-GACTKMPSTPFCR---NVGVAALPCAEKDGFIW  405


 Score = 17.3 bits (33),  Expect = 4.9
 Identities = 10/41 (24%), Positives = 18/41 (44%), Gaps = 0/41 (0%)

Query  5    WIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENR  45
            W+  +P V +  K+  Q        V+     GR++ W+ R
Sbjct  67   WLDSVPRVRVRTKDSRQLDDMLELAVLNERLAGRLEPWQAR  107


> Q8S7E1 Chlorophyllide a oxygenase, chloroplastic [Oryza sativa 
subsp. japonica]
Length=541

 Score = 59.7 bits (143),  Expect = 7e-14
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 9/107 (8%)

Query  5    WIPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQIWENRCPHRSVRLSLGEVHGESLI  64
            W P+  S  L+   ++     + + VI+R + GR     N C HR+  L LG V+   + 
Sbjct  220  WYPVAFSSDLKDDTMVPIDCFEEQWVIFRGKDGRPGCVMNTCAHRACPLHLGSVNEGRIQ  279

Query  65   CAYHGWQFSADHGQCQRIPAQP--TQRVPSTLCSTTYAVAEHDGMIW  109
            C YHGW++S D G+C+++P+      R+ S  C       E +GM+W
Sbjct  280  CPYHGWEYSTD-GKCEKMPSTKMLNVRIRSLPC------FEQEGMVW  319


 Score = 21.2 bits (43),  Expect = 0.29
 Identities = 9/36 (25%), Positives = 17/36 (47%), Gaps = 0/36 (0%)

Query  6   IPILPSVLLEPKEVIQAFVQDIEVVIWRSEQGRVQI  41
           +PI     L+  + ++    DI+   WR+ Q  + I
Sbjct  65  VPIAKGKFLDVNQALEVVRFDIQYCDWRARQDLLTI  100



Lambda      K        H        a         alpha
   0.323    0.133    0.438    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 742284


  Database: 9b523ca0a415c8c1dcadcfe7f20d39ab.SwissProt.fasta
    Posted date:  Jan 19, 2021  1:14 AM
  Number of letters in database: 4,696
  Number of sequences in database:  10



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40