ACIAD0123 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 989694bc7ef8abecb263412424fbab6f.TrEMBL.fasta
           23 sequences; 5,597 total letters



Query= ACIAD0123

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FFQ7 Putative pili assembly chaperone [Acinetobacter baylyi (...   501    0.0   
  N9BZL4 Uncharacterized protein [Acinetobacter soli NIPH 2899]        291    7e-102
  A0A241V6U2 Uncharacterized protein [Acinetobacter sp. ANC 4218]      203    2e-67 
  A0A240E6R0 P pilus assembly protein, chaperone PapD [Acinetobac...   194    1e-63 
  N8UZ23 PapD_N domain-containing protein [Acinetobacter sp. NIPH...   190    2e-62 
  V2V338 Uncharacterized protein [Acinetobacter tjernbergiae DSM ...   190    3e-62 
  A0A0B0KHK1 Pili assembly chaperone [Acinetobacter sp. neg1]          186    9e-61 
  W5IRC0 Pilus assembly protein [Pseudomonas sp. (strain M1)]          172    2e-55 
  A0A0V8T1N0 Molecular chaperone [Pseudomonas sp. (strain ADP)]        172    2e-55 
  A0A1A5DCM0 Molecular chaperone [Pseudomonas sp. EGD-AKN5]            172    2e-55 
  A0A2S9EE19 Molecular chaperone [Acinetobacter sp. MYb10]             169    4e-54 
  A0A0Q7FKN1 Pilus assembly protein [Acinetobacter sp. Root1280]       169    4e-54 
  N8WXG7 Uncharacterized protein [Acinetobacter guillouiae NIPH 991]   168    8e-54 
  Q9Z6F3 Uncharacterized protein [Yersinia pestis]                     161    2e-51 
  Q9Z394 Probable pili assembly chaperone [Yersinia pestis]            161    3e-51 
  O30925 F17-like fimbrial chaperone [Escherichia coli]                116    3e-34 
  Q849P8 Pilin chaperone ecpD1 [Salmonella dublin]                     108    2e-31 
  J7I7I6 Fimbrial chaperone protein FimC [Burkholderia multivorans]    105    6e-30 
  Q9HWU3 Chaperone CupB2 [Pseudomonas aeruginosa (strain ATCC 156...   103    2e-29 
  Q6Q279 AcuD [Acinetobacter baylyi (strain ATCC 33305 / BD413 / ...   101    1e-28 
  Q84CN1 Chaperone protein FocC [Escherichia coli]                     100    2e-28 
  K9R663 F17-like fimbrial chaperone [Gallibacterium anatis]          95.5    1e-26 
  A0A1C9FQP7 F17-like fimbrial chaperone [Avibacterium paragallin...  94.7    2e-26 


> Q6FFQ7 Putative pili assembly chaperone [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=245

 Score =  501 bits (1289),  Expect = 0.0
 Identities = 245/245 (100%), Positives = 245/245 (100%), Gaps = 0/245 (0%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60
            MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG
Sbjct  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120
            LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS
Sbjct  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120

Query  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180
            NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY
Sbjct  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180

Query  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKYIEFSVIAEDGFAYSF  240
            FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKYIEFSVIAEDGFAYSF
Sbjct  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKYIEFSVIAEDGFAYSF  240

Query  241  KYDYY  245
            KYDYY
Sbjct  241  KYDYY  245


> N9BZL4 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=234

 Score =  291 bits (744),  Expect = 7e-102
 Identities = 139/227 (61%), Positives = 184/227 (81%), Gaps = 2/227 (1%)

Query  19   AIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDHDQAPFVINPPIF  78
            AIAG+LPENTRVI++ + SSRSFIV N+N YP+LVQ WVD G GDP+  QAPF+INPP+F
Sbjct  7    AIAGLLPENTRVIYNSSESSRSFIVVNKNHYPVLVQAWVDDGAGDPNTKQAPFLINPPVF  66

Query  79   KMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQTQL  138
            KMQ  A+QVLKIIYTG+++ TD ESQFWLNLYE+PGK  + +     T++QLDL++QTQL
Sbjct  67   KMQSGAVQVLKIIYTGEKQDTDQESQFWLNLYEVPGKSSVFTGS--NTDNQLDLTMQTQL  124

Query  139  KVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIALISNKNSVFI  198
            K+FYRP K+ KM+++ +A QLKF+FK ID+Q YLI ENP+ YFISFS+I L S+++S+ +
Sbjct  125  KLFYRPKKVPKMDLQAVAAQLKFSFKTIDDQQYLISENPSAYFISFSEITLRSDQHSIPV  184

Query  199  EDYLDQMVAPNADQIYPIKYRIDDLKYIEFSVIAEDGFAYSFKYDYY  245
            +  L+QM+AP + Q+YPI +  D +K I+FS+I +DGFAYSFKY YY
Sbjct  185  QANLEQMLAPKSRQVYPIDHIPDQMKQIDFSLIGDDGFAYSFKYLYY  231


> A0A241V6U2 Uncharacterized protein [Acinetobacter sp. ANC 4218]
Length=254

 Score =  203 bits (517),  Expect = 2e-67
 Identities = 103/237 (43%), Positives = 152/237 (64%), Gaps = 2/237 (1%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60
            MK +L    I L    + A AGI+P ++RVI+      +S ++AN N YP++VQTWVD G
Sbjct  1    MKSILHLCYISLFAHSIVAQAGIVPASSRVIYAEQNREQSLLLANSNDYPVVVQTWVDDG  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120
             G+ +  +APFV+ P IFKM P  IQV++I+  GD    D ES +WLNLYEI GK   QS
Sbjct  61   SGNLNLAKAPFVVLPAIFKMNPKGIQVIRIVQNGDAMPADRESVYWLNLYEISGKTPEQS  120

Query  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180
                E   +LDL++ TQLK+FYRPA ++KMNIE+IA QL+F+ ++   Q +L+C NPTPY
Sbjct  121  QPVSENQARLDLAMNTQLKIFYRPAHLVKMNIEQIAAQLRFSLQQSAGQWFLLCHNPTPY  180

Query  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKY--IEFSVIAEDG  235
             ISF+ + +I ++ S  +   +D M    A++IYP++      ++  IEF+++ + G
Sbjct  181  HISFTGLKVIQDQQSRVVAKQMDMMTPAQANRIYPLEQAPQSTEFNRIEFTLLDDQG  237


> A0A240E6R0 P pilus assembly protein, chaperone PapD [Acinetobacter 
puyangensis]
Length=252

 Score =  194 bits (492),  Expect = 1e-63
 Identities = 98/240 (41%), Positives = 145/240 (60%), Gaps = 2/240 (1%)

Query  6    FTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPD  65
            F++ I   L+     AG     +R+I+    +++S  +AN N YPI+ QTW+D GLG+P 
Sbjct  8    FSIFIFCFLFSTTTFAGFATSTSRIIYMQNDNAQSVTLANINEYPIITQTWIDDGLGNPL  67

Query  66   HDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPE  125
              +APFVI P +FKM P  IQ L+I++ GD    D ES +WLNLYEIPGK K  S    E
Sbjct  68   QAKAPFVILPAVFKMNPQGIQALRIVHNGDAMPQDRESVYWLNLYEIPGKPKELSGPVTE  127

Query  126  TNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFS  185
               +LDL++ TQLK+FYRP  + KM+  +IA+QL+F  ++   Q  LIC NPTPY ISF+
Sbjct  128  NKARLDLAMNTQLKIFYRPKTLKKMDSTQIAQQLQFYLQQQQGQTILICHNPTPYHISFT  187

Query  186  KIALISNKNSVFIEDYLDQMVAPNADQIYPIK--YRIDDLKYIEFSVIAEDGFAYSFKYD  243
             +++      + I+  +D M  P + +IY ++   ++ D + I FS + + G +   KYD
Sbjct  188  GLSIFQAGKEIQIQQEMDMMTPPLSKRIYHLQNSSQLTDFEKINFSFVNDQGHSIVGKYD  247


> N8UZ23 PapD_N domain-containing protein [Acinetobacter sp. NIPH 
758]
Length=248

 Score =  190 bits (483),  Expect = 2e-62
 Identities = 94/243 (39%), Positives = 151/243 (62%), Gaps = 4/243 (2%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60
            M+ + F   I L      A AG++  ++R+I++     ++ I+AN N YPI+VQ W D G
Sbjct  1    MRSLAFIFSIFLFFISTDATAGLVTSSSRIIYEEGTREKTLIIANINDYPIVVQAWFDDG  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120
             G+P+++++PFVI P +F+MQP  IQ L++ Y G    ++ ES  WLNLYEIPG KK   
Sbjct  61   GGNPEYEKSPFVILPAVFRMQPAGIQSLRVFYNGAALPSNKESVVWLNLYEIPGVKK---  117

Query  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180
             +  + + +LD ++ TQLKVFYRP  + KM ++++ K+LKF+ ++ D +  L+CEN + Y
Sbjct  118  -EGADAHAKLDFAMNTQLKVFYRPKGLQKMKLQDLVKKLKFSIERQDEKAVLVCENSSAY  176

Query  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKYIEFSVIAEDGFAYSF  240
             +SF++I+LI       I   +D M +P + + Y ++  +D   YI+FS+I +DG  Y  
Sbjct  177  HLSFARISLIYQGEKTNIIQEMDMMSSPLSKRRYMLENPVDGFDYIDFSLIGDDGHIYHG  236

Query  241  KYD  243
            K D
Sbjct  237  KVD  239


> V2V338 Uncharacterized protein [Acinetobacter tjernbergiae DSM 
14971 = CIP 107465]
Length=248

 Score =  190 bits (482),  Expect = 3e-62
 Identities = 96/222 (43%), Positives = 142/222 (64%), Gaps = 4/222 (2%)

Query  21   AGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDHDQAPFVINPPIFKM  80
            AG    + RVI++ +    S I+AN N YPI+ QTWVD+G G PD   APFV+ P +FKM
Sbjct  22   AGFAISSNRVIYNESEREHSLILANINEYPIVAQTWVDNGAGYPDQSTAPFVVLPAVFKM  81

Query  81   QPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQTQLKV  140
             P  IQV++II+ G+    D ES FWLNLYEI GK + Q N   E+  +LDL++ TQLKV
Sbjct  82   NPKGIQVVRIIHNGNTMPQDRESVFWLNLYEILGKTQQQLNLSEESRVRLDLAMNTQLKV  141

Query  141  FYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIALISNKNSVFIED  200
            FYRP  +  M+IE+I++++KF  K+++    L+C NPTPY +SF  I L     +  IE+
Sbjct  142  FYRPKSLKPMDIEQISEKIKFFIKEVNGNQVLVCNNPTPYHLSFINIVLKQKDRNFEIEN  201

Query  201  YLDQMVAPNADQIYPIKYRIDDLKY---IEFSVIAEDGFAYS  239
             +D MVAP ++++Y +     +L Y   + F++I + G+ ++
Sbjct  202  QVDLMVAPFSEKVYELD-SSPELPYSYQVNFTLIDDQGYTFN  242


> A0A0B0KHK1 Pili assembly chaperone [Acinetobacter sp. neg1]
Length=248

 Score =  186 bits (472),  Expect = 9e-61
 Identities = 93/243 (38%), Positives = 147/243 (60%), Gaps = 4/243 (2%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60
            M+ + F   I L      A AG+   ++R+I++     +  I+AN N YPI+VQ W D G
Sbjct  1    MRSLAFIFSIFLFFISTDATAGLATSSSRIIYEEGTREKPLIIANINDYPIVVQAWFDDG  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120
             G+P+++++PFVI P +F+MQP  IQ L++ Y G     + ES  WLNLYEIPG KK   
Sbjct  61   SGNPEYEKSPFVILPAVFRMQPAGIQSLRVFYNGAALPPNKESVIWLNLYEIPGVKK---  117

Query  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180
             +  + + +LD ++ TQLKVFYR   + KM ++++ K+LKF+ ++ D +  L+CEN + Y
Sbjct  118  -EGADAHAKLDFAMNTQLKVFYRAKGLQKMKLQDLIKKLKFSIERQDEKAVLVCENSSAY  176

Query  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKYIEFSVIAEDGFAYSF  240
              SF++I+L+       I   +D M +P + + Y ++  ID  +YI+FS+I +DG  Y  
Sbjct  177  HFSFARISLVYQGEKTNIIQEMDMMSSPLSKRRYMLESSIDGFEYIDFSLIGDDGHIYHG  236

Query  241  KYD  243
            K D
Sbjct  237  KVD  239


> W5IRC0 Pilus assembly protein [Pseudomonas sp. (strain M1)]
Length=243

 Score =  172 bits (436),  Expect = 2e-55
 Identities = 91/231 (39%), Positives = 148/231 (64%), Gaps = 7/231 (3%)

Query  8    LIICLGLWGVPAI-AGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDH  66
            L++ L   G+PA  AG+L   TRVI+D     RS ++AN NPYP++VQTWVD G G P++
Sbjct  8    LLLALLAAGLPAAQAGVLAGGTRVIYDEGLRERSLMLANTNPYPVVVQTWVDGGGGAPEN  67

Query  67   DQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPET  126
             QAPF++ P +F+MQP  +Q L+II+TG+    D ES FWLNLYEIP    L   ++P+ 
Sbjct  68   AQAPFIVLPAVFRMQPGGLQGLRIIHTGEALPRDRESVFWLNLYEIP---PLAGRKEPDP  124

Query  127  NHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSK  186
              +++L++ TQLK+FYRPAK L +  +++A +L F+ ++  +  +L+C NPTPY  SF+ 
Sbjct  125  -ARVELAMNTQLKLFYRPAK-LPLPPDQVAGKLTFDLRREGDAWFLVCRNPTPYHASFTT  182

Query  187  IALISNKNSVFIEDYLDQMVAPNADQIYPIKY-RIDDLKYIEFSVIAEDGF  236
            + L  +  ++  +  +D M  P +++ Y ++   + +   + F ++ + GF
Sbjct  183  LGLSGDGRTLAAQQQMDMMTPPFSEKRYQLEEGALPNGARVSFRLVDDTGF  233


> A0A0V8T1N0 Molecular chaperone [Pseudomonas sp. (strain ADP)]
Length=243

 Score =  172 bits (436),  Expect = 2e-55
 Identities = 91/231 (39%), Positives = 148/231 (64%), Gaps = 7/231 (3%)

Query  8    LIICLGLWGVPAI-AGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDH  66
            L++ L   G+PA  AG+L   TRVI+D     RS ++AN NPYP++VQTWVD G G P++
Sbjct  8    LLLALLAAGLPAAQAGVLAGGTRVIYDEGLRERSLMLANTNPYPVVVQTWVDGGGGAPEN  67

Query  67   DQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPET  126
             QAPF++ P +F+MQP  +Q L+II+TG+    D ES FWLNLYEIP    L   ++P+ 
Sbjct  68   AQAPFIVLPAVFRMQPGGLQGLRIIHTGEALPRDRESVFWLNLYEIP---PLAGRKEPDP  124

Query  127  NHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSK  186
              +++L++ TQLK+FYRPAK L +  +++A +L F+ ++  +  +L+C NPTPY  SF+ 
Sbjct  125  -ARVELAMNTQLKLFYRPAK-LPLPPDQVAGKLTFDLRREGDAWFLVCRNPTPYHASFTT  182

Query  187  IALISNKNSVFIEDYLDQMVAPNADQIYPIKY-RIDDLKYIEFSVIAEDGF  236
            + L  +  ++  +  +D M  P +++ Y ++   + +   + F ++ + GF
Sbjct  183  LGLSGDGRTLAAQQQMDMMTPPFSEKRYQLEEGALPNGARVSFRLVDDTGF  233


> A0A1A5DCM0 Molecular chaperone [Pseudomonas sp. EGD-AKN5]
Length=243

 Score =  172 bits (436),  Expect = 2e-55
 Identities = 91/231 (39%), Positives = 148/231 (64%), Gaps = 7/231 (3%)

Query  8    LIICLGLWGVPAI-AGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDH  66
            L++ L   G+PA  AG+L   TRVI+D     RS ++AN NPYP++VQTWVD G G P++
Sbjct  8    LLLALLAAGLPAAQAGVLAGGTRVIYDEGLRERSLMLANTNPYPVVVQTWVDGGGGAPEN  67

Query  67   DQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPET  126
             QAPF++ P +F+MQP  +Q L+II+TG+    D ES FWLNLYEIP    L   ++P+ 
Sbjct  68   AQAPFIVLPAVFRMQPGGLQGLRIIHTGEALPRDRESVFWLNLYEIP---PLAGRKEPDP  124

Query  127  NHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSK  186
              +++L++ TQLK+FYRPAK L +  +++A +L F+ ++  +  +L+C NPTPY  SF+ 
Sbjct  125  -ARVELAMNTQLKLFYRPAK-LPLPPDQVAGKLTFDLRREGDAWFLVCRNPTPYHASFTT  182

Query  187  IALISNKNSVFIEDYLDQMVAPNADQIYPIKY-RIDDLKYIEFSVIAEDGF  236
            + L  +  ++  +  +D M  P +++ Y ++   + +   + F ++ + GF
Sbjct  183  LGLSGDGRTLAAQQQMDMMTPPFSEKRYQLEEGALPNGARVSFRLVDDTGF  233


> A0A2S9EE19 Molecular chaperone [Acinetobacter sp. MYb10]
Length=246

 Score =  169 bits (427),  Expect = 4e-54
 Identities = 94/244 (39%), Positives = 139/244 (57%), Gaps = 8/244 (3%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60
            MK+  FTL+     +     AG+L   TRV+F      +S ++AN N YPI++QTWVD G
Sbjct  1    MKITKFTLLCICLFYSFLCQAGVLAAKTRVVFKDGEHEQSLMLANTNDYPIILQTWVDQG  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120
             GDPD +  PF+I PP  K+  + I  L+I+Y G     D E+ FWLNLYEIP  K+  S
Sbjct  61   EGDPDINNMPFLILPPFVKLASNDIHGLRILYNGKALPNDRETVFWLNLYEIPMIKR-HS  119

Query  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180
            +Q    N    L++ TQLK+FYRP +I KM  E I +++ F   + D + Y+ CENPTPY
Sbjct  120  DQAAYMN----LAMNTQLKLFYRPKQIAKMLPEMIVEKIHFKIVEQDKKNYIECENPTPY  175

Query  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRI---DDLKYIEFSVIAEDGFA  237
              S   + + S+   ++I+  +D M  P + + Y I   +   D+L  + F+ + +DG A
Sbjct  176  HASLINLKIESSSQKIYIQSEMDMMCYPYSTKRYEIAGELNKSDNLYKLSFNFLDDDGNA  235

Query  238  YSFK  241
              F+
Sbjct  236  IHFQ  239


> A0A0Q7FKN1 Pilus assembly protein [Acinetobacter sp. Root1280]
Length=246

 Score =  169 bits (427),  Expect = 4e-54
 Identities = 94/244 (39%), Positives = 139/244 (57%), Gaps = 8/244 (3%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60
            MK+  FTL+     +     AG+L   TRV+F      +S ++AN N YPI++QTWVD G
Sbjct  1    MKITKFTLLCICLFYSFLCQAGVLAAKTRVVFKDGEHEQSLMLANTNDYPIILQTWVDQG  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120
             GDPD +  PF+I PP  K+  + I  L+I+Y G     D E+ FWLNLYEIP  K+  S
Sbjct  61   EGDPDINNMPFLILPPFVKLASNDIHGLRILYNGKALPNDRETVFWLNLYEIPMIKR-HS  119

Query  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180
            +Q    N    L++ TQLK+FYRP +I KM  E I +++ F   + D + Y+ CENPTPY
Sbjct  120  DQAAYMN----LAMNTQLKLFYRPKQIAKMLPEMIVEKIHFKIVEQDKKNYIECENPTPY  175

Query  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRI---DDLKYIEFSVIAEDGFA  237
              S   + + S+   ++I+  +D M  P + + Y I   +   D+L  + F+ + +DG A
Sbjct  176  HASLINLKIESSSQKIYIQSEMDMMCYPYSTKRYEIAGELNKNDNLYKLSFNFLDDDGNA  235

Query  238  YSFK  241
              F+
Sbjct  236  IHFQ  239


> N8WXG7 Uncharacterized protein [Acinetobacter guillouiae NIPH 
991]
Length=246

 Score =  168 bits (425),  Expect = 8e-54
 Identities = 93/244 (38%), Positives = 138/244 (57%), Gaps = 8/244 (3%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG  60
            MK+  FTL+     +     AG+L   TR++F      +S ++AN N YPI++QTWVD G
Sbjct  1    MKITKFTLLCICLFYSFLCQAGVLAAKTRIVFKDGEHEQSLMLANTNDYPIILQTWVDQG  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQS  120
             GDPD +  PF+I PP  K+  + I  L+I+Y G     D E+ FWLNLYEIP  K+  S
Sbjct  61   EGDPDINNMPFLILPPFVKLASNDIHGLRILYNGKALPNDRETVFWLNLYEIPMIKR-HS  119

Query  121  NQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPY  180
            +Q    N    L++ TQLK+FYRP +I KM  E I +++ F   + D + Y+ CENPTPY
Sbjct  120  DQAAYMN----LAMNTQLKLFYRPKQIAKMLPEMIVEKIHFKIVEQDKKKYIECENPTPY  175

Query  181  FISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRI---DDLKYIEFSVIAEDGFA  237
              S   + + S+   ++I+  +D M  P + + Y I   +   D+L  + F  + +DG A
Sbjct  176  HASLINLKIESSSQKIYIQSEMDMMCYPYSTKRYEIAGELNKNDNLYTLSFDFLDDDGNA  235

Query  238  YSFK  241
              F+
Sbjct  236  IHFQ  239


> Q9Z6F3 Uncharacterized protein [Yersinia pestis]
Length=241

 Score =  161 bits (408),  Expect = 2e-51
 Identities = 82/212 (39%), Positives = 131/212 (62%), Gaps = 7/212 (3%)

Query  5    LFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGD-  63
            L +L + L      A+AG++  +TR+I+      R+ ++AN N YP++VQTW+D+G  D 
Sbjct  3    LLSLFLLLFTISYDALAGLIAGSTRIIYQPELRERTLMLANTNDYPVVVQTWIDNGDVDS  62

Query  64   -PDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQ  122
             PD  +APF++ P +FKMQ  ++Q L+II  G+   +D ES +WLNLYEIP +++     
Sbjct  63   TPDQAKAPFMVLPAVFKMQAGSVQALRIINKGENLPSDRESVYWLNLYEIPPRER----S  118

Query  123  KPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFI  182
              + + Q+ +++ TQ+K+FYRP  +    I+ + K +KF+ K IDNQ  +I  NPTPYF+
Sbjct  119  NIDVHAQVAMAMNTQMKIFYRPNGLAPPPIDAMGK-IKFSLKNIDNQYVIIANNPTPYFV  177

Query  183  SFSKIALISNKNSVFIEDYLDQMVAPNADQIY  214
            SF +I L S + +  I   +D M  P + + Y
Sbjct  178  SFGQIQLQSQQKNYLIAQSMDMMTGPFSTRPY  209


> Q9Z394 Probable pili assembly chaperone [Yersinia pestis]
Length=246

 Score =  161 bits (408),  Expect = 3e-51
 Identities = 82/212 (39%), Positives = 131/212 (62%), Gaps = 7/212 (3%)

Query  5    LFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGD-  63
            L +L + L      A+AG++  +TR+I+      R+ ++AN N YP++VQTW+D+G  D 
Sbjct  3    LLSLFLLLFTISYDALAGLIAGSTRIIYQPELRERTLMLANTNDYPVVVQTWIDNGDVDS  62

Query  64   -PDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQ  122
             PD  +APF++ P +FKMQ  ++Q L+II  G+   +D ES +WLNLYEIP +++     
Sbjct  63   TPDQAKAPFMVLPAVFKMQAGSVQALRIINKGENLPSDRESVYWLNLYEIPPRER----S  118

Query  123  KPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFI  182
              + + Q+ +++ TQ+K+FYRP  +    I+ + K +KF+ K IDNQ  +I  NPTPYF+
Sbjct  119  NIDVHAQVAMAMNTQMKIFYRPNGLAPPPIDAMGK-IKFSLKNIDNQYVIIANNPTPYFV  177

Query  183  SFSKIALISNKNSVFIEDYLDQMVAPNADQIY  214
            SF +I L S + +  I   +D M  P + + Y
Sbjct  178  SFGQIQLQSQQKNYLIAQSMDMMTGPFSTRPY  209


> O30925 F17-like fimbrial chaperone [Escherichia coli]
Length=240

 Score =  116 bits (291),  Expect = 3e-34
 Identities = 70/236 (30%), Positives = 129/236 (55%), Gaps = 14/236 (6%)

Query  3    LVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG--  60
            L +FT+++ L  +G   I G     TRVI+     S +  + N +  P L+Q W+D G  
Sbjct  6    LFIFTVLLSLPSYGSVVIMG-----TRVIYPAEQKSINVRLNNGDSTPSLIQAWLDTGDP  60

Query  61   LGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQ-  119
               PD  + PF+I PP+F+M+P + Q ++I+YTG++   D ES FWLN+ +IP K     
Sbjct  61   SSPPDSVRVPFIITPPVFRMEPLSGQTMRIMYTGEKLPADRESLFWLNVLDIPAKPSFAG  120

Query  120  SNQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTP  179
             ++K +  + L  ++++++K F+RP   L  + ++  K++ +     D    L   NPTP
Sbjct  121  KSEKAQGYNYLQFAVRSRIKFFFRPDG-LPFSPDDAYKKVTWQLTGGDT---LQASNPTP  176

Query  180  YFISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKYIEFSVIAEDG  235
            YFI+FS +++   + +  +      M AP +   + +K ++     +E++V+ ++G
Sbjct  177  YFITFSTVSV--GQGAQKVSSTQGGMAAPFSSVTFRLKQKVSPSGKVEWTVVNDNG  230


> Q849P8 Pilin chaperone ecpD1 [Salmonella dublin]
Length=249

 Score =  108 bits (271),  Expect = 2e-31
 Identities = 71/216 (33%), Positives = 110/216 (51%), Gaps = 10/216 (5%)

Query  6    FTLIICLG-LWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLG--  62
            FT+I   G L    A A I+   TR+++ G     +  + N+   P+LVQTW+D G    
Sbjct  11   FTVITLTGTLLSNVAWADIVISGTRIVYRGAQKDVNVRLENKGSRPLLVQTWLDTGNDNT  70

Query  63   DPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQK-QTDFESQFWLNLYEIPGKKKLQSN  121
            +P   + PF   PP+ ++ P   Q +KI+YTG Q   +D ES FW N+ E+P   K   N
Sbjct  71   EPGAIKVPFNATPPVSRIDPKKGQTIKIMYTGSQTLPSDRESVFWFNVLEVP--PKANKN  128

Query  122  QKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYF  181
            +     + L  + +T++K+FYRP  +  +  E  AK L +  K    +  +   NPTPYF
Sbjct  129  ENSAAQNTLQSAFRTRIKLFYRPQGLGDLAGEAPAK-LTWRMKHEQGKSVVTVNNPTPYF  187

Query  182  ISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIK  217
            +SF+ I L S      ++    QM AP  +  + +K
Sbjct  188  VSFNSIELESTGKKYIVD---GQMAAPLTETSFTLK  220


> J7I7I6 Fimbrial chaperone protein FimC [Burkholderia multivorans]
Length=254

 Score =  105 bits (261),  Expect = 6e-30
 Identities = 63/199 (32%), Positives = 105/199 (53%), Gaps = 10/199 (5%)

Query  21   AGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGD--PDHDQAPFVINPPIF  78
            A ++   TRV++       +  + N+   P LVQ W+D G  +  PD  +APF++ PP+F
Sbjct  28   ASVVIGGTRVVYPEKDREVTVRLTNEGEKPALVQAWIDSGNPNALPDDTKAPFILTPPLF  87

Query  79   KMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQTQL  138
            ++ P   Q L+++YT D    D ES FWLN+ E+P +      Q     + L L+ +T++
Sbjct  88   RIDPAQGQSLRVLYTKDALPQDKESLFWLNVLEVPPEVAPDEAQP----NSLQLAFRTRI  143

Query  139  KVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLI-CENPTPYFISFSKIALISNKNSVF  197
            K+F+RPA  L+ +  E   ++ +   ++D   Y +   NPTPY ++FS++AL        
Sbjct  144  KLFFRPA-ALQDSAAEAPSKVTWKLARLDGGRYGVEAHNPTPYHVTFSRVAL--KTGDTV  200

Query  198  IEDYLDQMVAPNADQIYPI  216
              + L  MVAP     + I
Sbjct  201  RTNSLGGMVAPGGTATFGI  219


> Q9HWU3 Chaperone CupB2 [Pseudomonas aeruginosa (strain ATCC 15692 
/ DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / 
PRS 101 / PAO1)]
Length=248

 Score =  103 bits (258),  Expect = 2e-29
 Identities = 57/188 (30%), Positives = 105/188 (56%), Gaps = 18/188 (10%)

Query  8    LIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGD--PD  65
            + +C+G     A AG++ + TRV+F  +    +  V+N +  P+L Q W+D G  D  P+
Sbjct  19   IALCVGT----AHAGLIAQGTRVVFPASEREVTLRVSNTSGTPVLAQAWIDDGRQDVPPE  74

Query  66   HDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPE  125
              Q PF + P + +++P+   VL+I Y      TD ES FWLN+ E+P + +       +
Sbjct  75   ELQVPFSVTPAVTRVEPNGGAVLRIAYLKAPLPTDRESLFWLNILEVPPRDE-------D  127

Query  126  TNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKK---IDNQIYLICENPTPYFI  182
             N+ L  S +++ K+F+RP+++   +++  A +L++ F +      +  +   NPTPY++
Sbjct  128  ENNALQFSFRSRFKLFFRPSQL--KSVDSAAGKLQWKFLESGGAGKKTVVQVNNPTPYYV  185

Query  183  SFSKIALI  190
            SF+ + LI
Sbjct  186  SFASVELI  193


> Q6Q279 AcuD [Acinetobacter baylyi (strain ATCC 33305 / BD413 
/ ADP1)]
Length=235

 Score =  101 bits (251),  Expect = 1e-28
 Identities = 68/226 (30%), Positives = 119/226 (53%), Gaps = 15/226 (7%)

Query  6    FTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG--LGD  63
            F+ II + L      AG+  + TR+IF   A S S  + N    P LVQTW+D G     
Sbjct  4    FSFIISILLLSQYTNAGVSIDGTRIIFPSNAKSVSVQLRNGFATPALVQTWIDQGDMSSI  63

Query  64   PDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQK-QTDFESQFWLNLYEIPGKKKLQSNQ  122
            P  DQ PFV+ PP+ +++    Q+++II TG      D ES +W N+ +IP +     ++
Sbjct  64   PAADQIPFVLTPPLSRVEAKKGQIIRIIPTGSPALPQDRESLYWFNMLDIPPEDSANKDK  123

Query  123  KPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFI  182
                 + L  ++++++K+FYRP   LKM+ ++    + +++      + L   NPTPYF+
Sbjct  124  -----NILTFNVRSRIKLFYRPTG-LKMSSDKAFASVGYSYNNGTQAVTL--NNPTPYFV  175

Query  183  SFSKIALISNKNSVFIEDYLDQMVAPNADQI---YPIKYRIDDLKY  225
            + +K+    N++     +    M+AP + QI   + +K++ D + Y
Sbjct  176  TVTKVD-FKNQSQTASYNADVVMLAPFSQQILNKFQLKFKPDQMNY  220


> Q84CN1 Chaperone protein FocC [Escherichia coli]
Length=228

 Score =  100 bits (249),  Expect = 2e-28
 Identities = 68/225 (30%), Positives = 115/225 (51%), Gaps = 18/225 (8%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYP-ILVQTWVDH  59
            MK + F ++  L         G+    TRVI+DG     S  V N N     L+Q+W+D 
Sbjct  1    MKRISFAVLALLMTAQQCFAGGVALSTTRVIYDGGKKEASLTVENHNKNEEFLIQSWIDD  60

Query  60   GLGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQ  119
              G+    + PF+I PP+FK+ PD   VL+I+   D    D ES +W+N+  IP K    
Sbjct  61   VNGNK---KTPFIITPPLFKLDPDKNNVLRIVNIEDTLPKDRESVYWINVKAIPAK----  113

Query  120  SNQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTP  179
             + + E  + L ++++T+LK+FYRP  +   N+E + KQL+  F++ +NQI  +  N + 
Sbjct  114  -SAENENKNVLQIAVRTRLKLFYRPKGLPGSNLEAM-KQLR--FQRQNNQI--VVNNDSA  167

Query  180  YFISFSKIAL----ISNKNSVFIEDYLDQMVAPNADQIYPIKYRI  220
            Y ++F++ ++    I     V  +  L+  +       + +KY I
Sbjct  168  YNLTFNQFSINGQKIERAGMVLAKGKLNINLPAGTGNAHEVKYSI  212


 Score = 17.7 bits (34),  Expect = 4.6
 Identities = 11/50 (22%), Positives = 22/50 (44%), Gaps = 0/50 (0%)

Query  178  TPYFISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIKYRIDDLKYIE  227
            TP+ I+     L  +KN+V     ++  +  + + +Y I  +    K  E
Sbjct  67   TPFIITPPLFKLDPDKNNVLRIVNIEDTLPKDRESVYWINVKAIPAKSAE  116


> K9R663 F17-like fimbrial chaperone [Gallibacterium anatis]
Length=230

 Score = 95.5 bits (236),  Expect = 1e-26
 Identities = 60/184 (33%), Positives = 100/184 (54%), Gaps = 15/184 (8%)

Query  6    FTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG--LGD  63
            FT+II      V A   ++   TRVI+     + S  + N    P LVQ W+D+G     
Sbjct  6    FTIIIAFMAMSVSA--NVIITGTRVIYPSNQKNVSVQLTNAGTNPSLVQAWIDNGDPKAS  63

Query  64   PDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQK  123
            P+  + PFVI PPI ++  +  Q L+I YTG     D ES F+LN+ +IP K K QS   
Sbjct  64   PETIKTPFVITPPISRIDGNKGQTLRITYTGASLPNDRESIFYLNVLDIPPKPKDQS---  120

Query  124  PETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFIS  183
                + L +++++++K+F+RP + L ++  +   Q+K+          L+ +NPTPY+I+
Sbjct  121  ---QNYLQIALRSRIKLFFRPVE-LTISPSDAYSQVKWR----GQGKQLLVDNPTPYYIT  172

Query  184  FSKI  187
            + ++
Sbjct  173  YPEV  176


> A0A1C9FQP7 F17-like fimbrial chaperone [Avibacterium paragallinarum]
Length=230

 Score = 94.7 bits (234),  Expect = 2e-26
 Identities = 60/186 (32%), Positives = 104/186 (56%), Gaps = 15/186 (8%)

Query  6    FTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG--LGD  63
            FT+II      V A   ++   TRVI+     + S  + N    P LVQ W+D+G     
Sbjct  6    FTIIIAFMAMSVSA--NVIITGTRVIYPSNQKNVSVQLTNAGTNPSLVQAWIDNGDPKAP  63

Query  64   PDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQK  123
            P+  + PFVI PPI ++  +  Q L+I YTG     D ES F+LN+ +IP K K Q+   
Sbjct  64   PETIKTPFVITPPISRIDGNKGQTLRITYTGASLPKDRESIFYLNVLDIPPKPKDQN---  120

Query  124  PETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFIS  183
                + L +S+++++K+F+RP + L ++  +   Q+K+  +    Q+++  +NPTPY+I+
Sbjct  121  ---QNYLQISLRSRIKLFFRPVE-LTISPSDAYSQVKWRGQ--GKQLFV--DNPTPYYIT  172

Query  184  FSKIAL  189
            + ++ +
Sbjct  173  YPEVKI  178



Lambda      K        H        a         alpha
   0.325    0.142    0.432    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 926170


  Database: 989694bc7ef8abecb263412424fbab6f.TrEMBL.fasta
    Posted date:  Sep 26, 2020  8:06 PM
  Number of letters in database: 5,597
  Number of sequences in database:  23



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40