ACIAD0123 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 6c52a9aab638c27406267b906c99bb27.SwissProt.fasta
           15 sequences; 3,574 total letters



Query= ACIAD0123

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P42914 Probable fimbrial chaperone YraI [Escherichia coli (stra...  96.3    4e-27
  P33128 Probable fimbrial chaperone YadV [Escherichia coli (stra...  95.5    1e-26
  P33409 Chaperone protein FimB/FhaD [Bordetella pertussis (strai...  94.7    2e-26
  P43661 Chaperone protein LpfB [Salmonella typhimurium (strain L...  93.2    5e-26
  Q8X5K6 Probable fimbrial chaperone LpfB [Escherichia coli O157:H7]  92.0    1e-25
  P53519 Chaperone protein CssC [Escherichia coli]                    89.7    9e-25
  P35757 Chaperone protein HifB [Haemophilus influenzae]              89.7    1e-24
  P53518 Chaperone protein CssC [Escherichia coli]                    89.0    2e-24
  P45991 Chaperone protein HifB [Haemophilus influenzae]              89.0    2e-24
  P37923 Chaperone protein FimC [Salmonella typhimurium (strain L...  86.7    1e-23
  P33387 Chaperone protein SefB [Salmonella enteritidis]              86.7    1e-23
  P21646 Chaperone protein MrkB [Klebsiella pneumoniae]               80.5    1e-21
  P15319 Chaperone protein PapD [Escherichia coli]                    79.7    3e-21
  P31697 Chaperone protein FimC [Escherichia coli (strain K12)]       79.3    3e-21
  P53520 Chaperone protein PmfD [Proteus mirabilis (strain HI4320)]   79.0    5e-21


> P42914 Probable fimbrial chaperone YraI [Escherichia coli (strain 
K12)]
Length=231

 Score = 96.3 bits (238),  Expect = 4e-27
 Identities = 65/187 (35%), Positives = 105/187 (56%), Gaps = 14/187 (7%)

Query  4    VLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPY-PILVQTWVDHGLG  62
            V+ TL+ C    G     GI+ + TRVI+D +    +  VAN+    P L+Q+WVD+  G
Sbjct  8    VILTLL-CSFCIGQALAGGIVLQRTRVIYDASRKEAALPVANKGAETPYLLQSWVDNIDG  66

Query  63   DPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQ  122
                 +APF+I PP+F+++      L+II T D    + ES F++N+  IP KKK     
Sbjct  67   K---SRAPFIITPPLFRLEAGDDSSLRIIKTADNLPENKESLFYINVRAIPAKKK----S  119

Query  123  KPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFI  182
                 ++L L  +T++K+FYRPA  LK  + +  K L+  FK+ D+ + +   NPT Y++
Sbjct  120  DDVNANELTLVFKTRIKMFYRPAH-LKGRVNDAWKSLE--FKRSDHSLNIY--NPTEYYV  174

Query  183  SFSKIAL  189
             F+ +A+
Sbjct  175  VFAGLAV  181


> P33128 Probable fimbrial chaperone YadV [Escherichia coli (strain 
K12)]
Length=246

 Score = 95.5 bits (236),  Expect = 1e-26
 Identities = 64/201 (32%), Positives = 103/201 (51%), Gaps = 10/201 (5%)

Query  19   AIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHG--LGDPDHDQAPFVINPP  76
            +IA I+   TRVI+     S +  + N+   P+LVQ+W+D G    +P     PF   PP
Sbjct  23   SIADIVISGTRVIYKSDQKSVNVRLENKGNNPLLVQSWLDTGDDNAEPGSITVPFTATPP  82

Query  77   IFKMQPDAIQVLKIIYTGDQK-QTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQ  135
            + ++     Q +K++YT       D ES FW N+ E+P K      +K      L L+ +
Sbjct  83   VSRIDAKRGQTIKLMYTASTSLPKDRESVFWFNVLEVPPK---PDAEKVANQSLLQLAFR  139

Query  136  TQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIALISNKNS  195
            T++K+FYRP   LK N  E    LK+ +   + +  L   NPTPY++SFS   L ++   
Sbjct  140  TRIKLFYRPDG-LKGNPSEAPLALKWFWSGSEGKASLRVTNPTPYYVSFSSGDLEASGKR  198

Query  196  VFIEDYLDQMVAPNADQIYPI  216
              I+    +M+AP +D++  +
Sbjct  199  YPID---VKMIAPFSDEVMKV  216


> P33409 Chaperone protein FimB/FhaD [Bordetella pertussis (strain 
Tohama I / ATCC BAA-589 / NCTC 13251)]
Length=244

 Score = 94.7 bits (234),  Expect = 2e-26
 Identities = 65/181 (36%), Positives = 98/181 (54%), Gaps = 17/181 (9%)

Query  19   AIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGD--PDHDQAPFVINPP  76
            A A ++   TRVI++  +   +  ++N+   P L+Q W+D G  +  PD  Q PF + PP
Sbjct  25   ARASLVITGTRVIYNAGSPETTVKMSNEGQAPALMQAWIDDGNAEAKPDEVQVPFFLTPP  84

Query  77   IFKMQPDAIQVLKIIYTG--DQK--QTDFESQFWLNLYEIPGKKKLQSNQKPETNH-QLD  131
            + ++ P   Q L+I + G  D K   +D ES FWLN+ E+P K        PE  H  L 
Sbjct  85   LARVDPGKGQTLRIFFNGYPDGKTLPSDRESVFWLNVLEVPPK------ATPEEGHGVLQ  138

Query  132  LSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIALIS  191
            L+I+++LK+FYRP K L  N    A  L   FK+  N + L   NPTPY+++  K+ +  
Sbjct  139  LTIRSRLKLFYRP-KGLSGNPLTAAADL--TFKRKPNGV-LEVHNPTPYYVNLQKLEVGE  194

Query  192  N  192
            N
Sbjct  195  N  195


> P43661 Chaperone protein LpfB [Salmonella typhimurium (strain 
LT2 / SGSC1412 / ATCC 700720)]
Length=232

 Score = 93.2 bits (230),  Expect = 5e-26
 Identities = 58/166 (35%), Positives = 96/166 (58%), Gaps = 13/166 (8%)

Query  22   GILPENTRVIFDGTASSRSFIVANQNPYP-ILVQTWVDHGLGDPDHDQAPFVINPPIFKM  80
            G+   +TRVI+DG+    S  V N++     L+Q+W+D   G+    + PF+I PP+FK+
Sbjct  25   GVALSSTRVIYDGSRKEASLTVNNKSTTDEFLIQSWIDDANGNK---KTPFIITPPLFKL  81

Query  81   QPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQTQLKV  140
             P    VL+I+ T +    D ES +W+N+  IP K     ++  E  + L ++++T+LK+
Sbjct  82   SPTKNNVLRIVNTTNTLPQDRESVYWINVKAIPAK-----SEDAEAKNVLQIAVRTRLKL  136

Query  141  FYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSK  186
            FYRPA  LK N  +   +L+F      NQI +  ENP+ + ++F+K
Sbjct  137  FYRPAG-LKGNSMDGWNKLQFTSAGA-NQIKV--ENPSAFNLTFNK  178


> Q8X5K6 Probable fimbrial chaperone LpfB [Escherichia coli O157:H7]
Length=232

 Score = 92.0 bits (227),  Expect = 1e-25
 Identities = 59/187 (32%), Positives = 101/187 (54%), Gaps = 14/187 (7%)

Query  1    MKLVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYP-ILVQTWVDH  59
            MK     L + L L       G+   +TRVI+DG+    S  V N++     L+Q+WVD 
Sbjct  5    MKSKFVALALSLFLSQSVLAGGVGLSSTRVIYDGSKKEASLTVQNKSKTEEFLIQSWVDD  64

Query  60   GLGDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQ  119
              G     + PF+I PP+FK+ P+   +L+I+        D ES +W+N+  IP K    
Sbjct  65   AAGSK---KTPFIITPPLFKLDPEKNNILRIVNITPGLPQDRESVYWVNVKAIPSK----  117

Query  120  SNQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTP  179
             +   E  + L ++++T++K+FYRPA  LK +++    +L+F   +  NQ+ +  +NPT 
Sbjct  118  -SDDSENKNVLQIAVRTRIKLFYRPAG-LKGDVKTAPNELRFT--RNGNQLRV--DNPTV  171

Query  180  YFISFSK  186
            + I+F++
Sbjct  172  FNITFNQ  178


> P53519 Chaperone protein CssC [Escherichia coli]
Length=232

 Score = 89.7 bits (221),  Expect = 9e-25
 Identities = 60/201 (30%), Positives = 109/201 (54%), Gaps = 15/201 (7%)

Query  28   TRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDHDQAPFVINPPIFKMQPDAIQV  87
            TRVI+    S+ S  ++N   YP+++Q+ V     + +HD   F+  PPIFKM+ ++  +
Sbjct  28   TRVIYSD--STPSVQISNNKAYPLIIQSNVWDESNNKNHD---FIATPPIFKMESESRNI  82

Query  88   LKIIYTGDQKQTDFESQFWLNLYEIPG-KKKLQSNQKPETNHQLDLSIQTQLKVFYRPAK  146
            +KII T        ES  WL +  +P  +K  + N+K      +++SI+  +K+ YRPA 
Sbjct  83   IKIIKTTINLPDSQESMRWLCIESMPPIEKSTKINRKEGRTDSINISIRGCIKLIYRPAS  142

Query  147  ILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIALISN-----KNSVFIEDY  201
            +       I ++LK++     N  YL+ +N TPY+ISFS++   S+     K+ ++++ Y
Sbjct  143  VPSPVFNNIVEKLKWH----KNGKYLVLKNNTPYYISFSEVFFDSDKVNNAKDILYVKPY  198

Query  202  LDQMVAPNADQIYPIKYRIDD  222
             ++ +  +   I  IK+ + D
Sbjct  199  SEKKIDISNRIIKKIKWAMID  219


> P35757 Chaperone protein HifB [Haemophilus influenzae]
Length=241

 Score = 89.7 bits (221),  Expect = 1e-24
 Identities = 65/218 (30%), Positives = 113/218 (52%), Gaps = 16/218 (7%)

Query  3    LVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGL-  61
            L+ FT +    L    A A ++   TRVI+     +    + N +    LVQ W+D+G  
Sbjct  10   LLFFTALFFTALCAFSANANVIITGTRVIYPAGQKNVIVKLENNDDSAALVQAWIDNGNP  69

Query  62   -GDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQK-QTDFESQFWLNLYEIPGKKKLQ  119
              DP + + PFVI PP+ +++  + Q L+I +TG +    D ES F+ NL +IP K   +
Sbjct  70   NADPKYTKTPFVITPPVARVEAKSGQSLRITFTGGEPLPDDRESLFYFNLLDIPPKPDAE  129

Query  120  SNQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTP  179
               K  +  Q  ++I+++LK+FYRPA   K++++      K  FK     +  + +N TP
Sbjct  130  FLAKHGSFMQ--IAIRSRLKLFYRPA---KLSLDPFDAMKKVVFKATPKGV--LVDNQTP  182

Query  180  YFISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIK  217
            Y++++  + L  NK +  +     +MVAP +  ++  K
Sbjct  183  YYMNYIGL-LHQNKPAKNV-----KMVAPFSQAVFEAK  214


> P53518 Chaperone protein CssC [Escherichia coli]
Length=232

 Score = 89.0 bits (219),  Expect = 2e-24
 Identities = 59/201 (29%), Positives = 110/201 (55%), Gaps = 15/201 (7%)

Query  28   TRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDHDQAPFVINPPIFKMQPDAIQV  87
            TRVI+    S+ S  ++N   YP++VQ+ +     + +HD   F+  PPIFKM+ ++  +
Sbjct  28   TRVIYSD--STPSVQISNNKAYPLIVQSNIWDENNNKNHD---FIATPPIFKMESESRNI  82

Query  88   LKIIYTGDQKQTDFESQFWLNLYEI-PGKKKLQSNQKPETNHQLDLSIQTQLKVFYRPAK  146
            +KII T  +     ES  WL +  + P +K  + N+K      +++SI+  +K+ Y+PA 
Sbjct  83   IKIIKTNIKLPDSQESMRWLCIESMPPTEKSTKINRKEGRTDSINISIRGCIKLIYQPAS  142

Query  147  ILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIALISN-----KNSVFIEDY  201
            +       I ++LK++     N  YL+ +N TPY+ISFS++   S+     K+ ++++ Y
Sbjct  143  VPSPVFNNIVEKLKWH----KNGKYLVLKNNTPYYISFSEVFFDSDKVNNAKDILYVKPY  198

Query  202  LDQMVAPNADQIYPIKYRIDD  222
             ++ +  +   I  IK+ + D
Sbjct  199  SEKKIDISNRIIKKIKWAMID  219


> P45991 Chaperone protein HifB [Haemophilus influenzae]
Length=241

 Score = 89.0 bits (219),  Expect = 2e-24
 Identities = 66/218 (30%), Positives = 113/218 (52%), Gaps = 16/218 (7%)

Query  3    LVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGL-  61
            L+ FT +    L    A A ++   TRVI+     +    + N +    LVQ W+D+G  
Sbjct  10   LLFFTALFFAALCAFSANADVIITGTRVIYPAGQKNVIVKLENNDDSAALVQAWIDNGNP  69

Query  62   -GDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQK-QTDFESQFWLNLYEIPGKKKLQ  119
              DP + + PFVI PP+ +++  + Q L+I +TG +    D ES F+ NL +IP K    
Sbjct  70   NADPKYTKTPFVITPPVARVEAKSGQSLRITFTGSEPLPDDRESLFYFNLLDIPPKPDAA  129

Query  120  SNQKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTP  179
               K  +  Q  ++I+++LK+FYRPAK L M+  +  K++ F          ++ +N TP
Sbjct  130  FLAKHGSFMQ--IAIRSRLKLFYRPAK-LSMDSRDAMKKVVFKATPEG----VLVDNQTP  182

Query  180  YFISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPIK  217
            Y++++  + L  NK +  +     +MVAP +  ++  K
Sbjct  183  YYMNYIGL-LHQNKPAKNV-----KMVAPFSQAVFEAK  214


> P37923 Chaperone protein FimC [Salmonella typhimurium (strain 
LT2 / SGSC1412 / ATCC 700720)]
Length=230

 Score = 86.7 bits (213),  Expect = 1e-23
 Identities = 65/215 (30%), Positives = 105/215 (49%), Gaps = 23/215 (11%)

Query  3    LVLFTLIICLGLWGVPAIAGILPENTRVIFDGTASSRSFIVANQNPYP-ILVQTWVDHGL  61
            +VL TL   L    V A  GI    TRVI+   A   S  ++N +     LV +W+++  
Sbjct  10   IVLLTLFTSLN---VQAAGGIALGATRVIYPSAAKQTSLAISNSDTQERYLVNSWIENNA  66

Query  62   GDPDHDQAPFVINPPIFKMQPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSN  121
            G  +     F++ PP+F  +P +   L+IIY G     D ES FW+N+  IP   K    
Sbjct  67   GQKEKT---FIVTPPLFVSEPKSENTLRIIYAGQPLPGDRESLFWMNVKAIPSVDK----  119

Query  122  QKPETNHQLDLSIQTQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYF  181
               E  + L L+I +++K+F RPA  L    E+    LKF+  ++ N  +L   NP+ Y+
Sbjct  120  SHIEGKNVLQLAILSRIKLFVRPAN-LPQTPEDAPTLLKFS--RVGN--HLKITNPSAYY  174

Query  182  ISFSKIALISNKNSVFIEDYLDQMVAPNADQIYPI  216
            ++   I++ + K         + M+AP +D   P+
Sbjct  175  LTLVNISVGAKKID-------NVMIAPKSDMQIPL  202


> P33387 Chaperone protein SefB [Salmonella enteritidis]
Length=246

 Score = 86.7 bits (213),  Expect = 1e-23
 Identities = 58/168 (35%), Positives = 90/168 (54%), Gaps = 10/168 (6%)

Query  22   GILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGDPDHDQAPFVINPPIFKMQ  81
            G+    TRVI+   A S SF + N+  YPILVQT V     D    +APF++ PPI K++
Sbjct  41   GLRLGTTRVIYKEDAPSTSFWIMNEKEYPILVQTQV---YNDDKSSKAPFIVTPPILKVE  97

Query  82   PDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQTQ--LK  139
             +A   LK+I T +    + ES +WL +  +P     +SN K      L++++ T   +K
Sbjct  98   SNARTRLKVIPTSNLFNKNEESLYWLCVKGVPPLNDNESNNKNNITTNLNVNVVTNSCIK  157

Query  140  VFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKI  187
            + YRP K + +   EIA +LK   K   N I  + +NPT  +++ + I
Sbjct  158  LIYRP-KTIDLTTMEIADKLKLERK--GNSI--VIKNPTSSYVNIANI  200


> P21646 Chaperone protein MrkB [Klebsiella pneumoniae]
Length=233

 Score = 80.5 bits (197),  Expect = 1e-21
 Identities = 55/169 (33%), Positives = 90/169 (53%), Gaps = 12/169 (7%)

Query  23   ILPENTRVIFDGTASSRSFIVANQNPYPILVQTWVDHGLGD--PDHDQAPFVINPPIFKM  80
            I+   TR I+ G     +  ++N    P L   W+D+G  D  PD    PF+I PPI ++
Sbjct  21   IIVNGTRFIYPGNEKEITVQLSNTADRPALATAWLDNGNADATPDTITTPFIITPPISRV  80

Query  81   QPDAIQVLKI-IYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQTQLK  139
               + Q L+I + +      D E+ +WLNL EIP    ++++QK E  + L L+I+++ K
Sbjct  81   DAKSGQTLRIKLGSNAGLAKDKETLWWLNLLEIP---PVEASQKNEGQNILQLAIRSRFK  137

Query  140  VFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIA  188
              YRPA +   N +  A++L  +     N   L   NPTP++I+ S+I+
Sbjct  138  FIYRPAGL--GNRDAAAEKLALS----ANGSSLSVSNPTPFYITVSRIS  180


> P15319 Chaperone protein PapD [Escherichia coli]
Length=239

 Score = 79.7 bits (195),  Expect = 3e-21
 Identities = 61/212 (29%), Positives = 104/212 (49%), Gaps = 19/212 (9%)

Query  19   AIAGILPENTRVIFDGTASSRSFIVANQNPY-PILVQTWVDHGLGDPDHDQAPFVINPPI  77
            A A +  + TR +FDG+  S +  ++N N   P L Q W+++          P +  PP+
Sbjct  19   ADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENE-NQEKIITGPVIATPPV  77

Query  78   FKMQPDAIQVLKIIYTGDQKQT--DFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQ  135
             +++P A  ++++  T D  +   D ES F+ NL EIP +         E  + L +++Q
Sbjct  78   QRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRS--------EKANVLQIALQ  129

Query  136  TQLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIALISNKNS  195
            T++K+FYRPA I     E    QL  N  K+     +  ENPTPY+++   I L  ++  
Sbjct  130  TKIKLFYRPAAIKTRPNEVWQDQLILN--KVSGGYRI--ENPTPYYVTV--IGLGGSEKQ  183

Query  196  VFIEDYLDQMVAPNADQ-IYPIKYRIDDLKYI  226
                ++   M++P ++Q +    Y    L YI
Sbjct  184  AEEGEFETVMLSPRSEQTVKSANYNTPYLSYI  215


> P31697 Chaperone protein FimC [Escherichia coli (strain K12)]
Length=241

 Score = 79.3 bits (194),  Expect = 3e-21
 Identities = 55/171 (32%), Positives = 94/171 (55%), Gaps = 15/171 (9%)

Query  19   AIAGILPENTRVIFDGTASSRSFIVANQNPYPI-LVQTWVDHGLGDPDHDQAPFVINPPI  77
            A AG+    TRVI+          V N +     L+Q+WV++  G  D     F++ PP+
Sbjct  34   AEAGVALGATRVIYPAGQKQEQLAVTNNDENSTYLIQSWVENADGVKD---GRFIVTPPL  90

Query  78   FKMQPDAIQVLKII-YTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQT  136
            F M+      L+I+  T +Q   D ES FW+N+  IP   K +      T + L L+I +
Sbjct  91   FAMKGKKENTLRILDATNNQLPQDRESLFWMNVKAIPSMDKSKL-----TENTLQLAIIS  145

Query  137  QLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKI  187
            ++K++YRPAK L +  ++ A++L+  F++  N + LI  NPTPY+++ +++
Sbjct  146  RIKLYYRPAK-LALPPDQAAEKLR--FRRSANSLTLI--NPTPYYLTVTEL  191


> P53520 Chaperone protein PmfD [Proteus mirabilis (strain HI4320)]
Length=254

 Score = 79.0 bits (193),  Expect = 5e-21
 Identities = 61/202 (30%), Positives = 105/202 (52%), Gaps = 19/202 (9%)

Query  21   AGILPENTRVIFDGTASSRSFIVANQNP-YPILVQTWVDHGLGDPDHDQAPFVINPPIFK  79
            AG+  + TR++  G  +S S  + N +P  P L Q+WV++  G      +P V  PP+ +
Sbjct  26   AGVSLDRTRIVLTGNENSASVNLKNTSPDIPFLAQSWVENENGQKI--SSPLVALPPLQR  83

Query  80   M---QPDAIQVLKIIYTGDQKQTDFESQFWLNLYEIPGKKKLQSNQKPETNHQLDLSIQT  136
            +   Q   +++ K    G   Q D ES F+LN+ EIP          P+  + L +++Q+
Sbjct  84   LDGAQKGVVRITKTAEVGLLPQ-DRESLFYLNVREIP--------PAPKQANVLQMAMQS  134

Query  137  QLKVFYRPAKILKMNIEEIAKQLKFNFKKIDNQIYLICENPTPYFISFSKIA-LISNKNS  195
            ++K+FYRP+ I+      +  Q +  FKK  N+   I  NPTPY+I+   ++  ++ ++S
Sbjct  135  RIKLFYRPSAIVPEK-PGMVWQDQLVFKKQGNK--FIVNNPTPYYITIISLSNKLNGEDS  191

Query  196  VFIEDYLDQMVAPNADQIYPIK  217
              +  +   MVAP A    P+K
Sbjct  192  DKLTTFPGLMVAPKASLDIPVK  213



Lambda      K        H        a         alpha
   0.325    0.142    0.432    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 606595


  Database: 6c52a9aab638c27406267b906c99bb27.SwissProt.fasta
    Posted date:  Sep 24, 2020  3:56 AM
  Number of letters in database: 3,574
  Number of sequences in database:  15



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40