ACIAD0108 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 8fa82d34b61095e4de3b9c91c1049880.TrEMBL.fasta
           19 sequences; 7,291 total letters



Query= ACIAD0108

Length=385
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A009YMK2 L-lactate dehydrogenase [Acinetobacter sp. 479375]        737    0.0   
  N9S7P4 L-lactate dehydrogenase [Acinetobacter ursingii NIPH 706]     737    0.0   
  N9DJG2 L-lactate dehydrogenase [Acinetobacter ursingii ANC 3649]     731    0.0   
  A0A0M1I3N3 L-lactate dehydrogenase [Acinetobacter sp. C15]           715    0.0   
  A0A1P8ELC7 L-lactate dehydrogenase [Acinetobacter soli]              715    0.0   
  N9AJJ2 L-lactate dehydrogenase [Acinetobacter soli NIPH 2899]        713    0.0   
  A0A1C4GS64 L-lactate dehydrogenase [Acinetobacter albensis]          709    0.0   
  A0A0M5JJY5 L-lactate dehydrogenase [Acinetobacter sp. TTH0-4]        707    0.0   
  A0A1Y3CHL4 L-lactate dehydrogenase [Acinetobacter sp. ANC 4999]      707    0.0   
  A0A172PZC2 L-lactate dehydrogenase [Acinetobacter baumannii]         705    0.0   
  I1SLB1 L-lactate dehydrogenase [Pseudomonas stutzeri]                637    0.0   
  Q51135 Alpha-hydroxy-acid oxidizing protein [Neisseria meningit...   326    3e-111
  Q9X4F0 Alpha-hydroxy-acid oxidizing protein [Rhodobacter sphaer...   309    1e-104
  I6TUB3 Hydroxymandelate oxidase [Streptomyces parvus]                242    8e-79 
  A0A2P2CL53 2-hydroxy-acid oxidase [Streptomyces sp. CNB091]          240    3e-78 
  R9RKA7 S-mandelate dehydrogenase [Pseudomonas aeruginosa]            239    2e-77 
  A0A0P0KG57 Hydroxymandelate oxidase [Streptomyces sp. DSM 11171]     238    3e-77 
  Q93N79 Glycolate oxidase [Streptomyces lavendulae]                   238    3e-77 
  B5AEM8 L-lactate dehydrogenase [Mycobacterium lepromatosis]          238    5e-77 


> A0A009YMK2 L-lactate dehydrogenase [Acinetobacter sp. 479375]
Length=385

 Score =  737 bits (1902),  Expect = 0.0
 Identities = 365/384 (95%), Positives = 378/384 (98%), Gaps = 0/384 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISSSNDYREAA+RRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL
Sbjct  1    MIISSSNDYREAARRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEVTPAI
Sbjct  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVTPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGLLGRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLLGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            LTILADSGIRNGLDVVRMLALGADSVMLGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNKLIQS  384
            LTGAK+IADIN  CLV++NKL+Q+
Sbjct  361  LTGAKSIADINTDCLVQVNKLMQA  384


> N9S7P4 L-lactate dehydrogenase [Acinetobacter ursingii NIPH 706]
Length=385

 Score =  737 bits (1902),  Expect = 0.0
 Identities = 365/384 (95%), Positives = 378/384 (98%), Gaps = 0/384 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISSSNDYREAA+RRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL
Sbjct  1    MIISSSNDYREAARRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEVTPAI
Sbjct  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVTPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGLLGRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLLGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            LTILADSGIRNGLDVVRMLALGADSVMLGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNKLIQS  384
            LTGAK+IADIN  CLV++NKL+Q+
Sbjct  361  LTGAKSIADINTDCLVQVNKLMQA  384


> N9DJG2 L-lactate dehydrogenase [Acinetobacter ursingii ANC 3649]
Length=384

 Score =  731 bits (1888),  Expect = 0.0
 Identities = 363/384 (95%), Positives = 377/384 (98%), Gaps = 0/384 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISSSNDYREAA+RRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL
Sbjct  1    MIISSSNDYREAARRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEVTPAI
Sbjct  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVTPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  GRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGLLGRPHDLGNISKYLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLLGRPHDLGNISKYLGKPTGLEDYIGWLGTNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAA GGQGVSNLL+LIDKEMRVAMT
Sbjct  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAAGGQGVSNLLELIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNKLIQS  384
            LTGAK+IA+IN  CLV++NKLIQ+
Sbjct  361  LTGAKSIAEINADCLVQVNKLIQA  384


> A0A0M1I3N3 L-lactate dehydrogenase [Acinetobacter sp. C15]
Length=384

 Score =  715 bits (1846),  Expect = 0.0
 Identities = 350/382 (92%), Positives = 372/382 (97%), Gaps = 0/382 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISSSNDYREAA+RRLPPFLFHYIDGGAY+E TLKRNVEDL+ +ALRQRVL DMS+LSL
Sbjct  1    MIISSSNDYREAAQRRLPPFLFHYIDGGAYSESTLKRNVEDLAHVALRQRVLKDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET+LFNETLSMP+ALSPVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEVTPAI
Sbjct  61   ETQLFNETLSMPLALSPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVTPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  QRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQS+MHP WAWDVGLLGRPHDLGNISKYLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQSVMHPHWAWDVGLLGRPHDLGNISKYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            LTILADSGIRNGLD+VRMLALGADSVM+GRAF+YALAAQGGQGVSNLLDL++KEMRVAMT
Sbjct  301  LTILADSGIRNGLDIVRMLALGADSVMIGRAFVYALAAQGGQGVSNLLDLLEKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNKLI  382
            LTG K IADI+ SCLVEMNK +
Sbjct  361  LTGVKRIADIDSSCLVEMNKAL  382


> A0A1P8ELC7 L-lactate dehydrogenase [Acinetobacter soli]
Length=384

 Score =  715 bits (1846),  Expect = 0.0
 Identities = 350/382 (92%), Positives = 372/382 (97%), Gaps = 0/382 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISSSNDYREAA+RRLPPFLFHYIDGGAY+E TLKRNVEDL+ +ALRQRVL DMS+LSL
Sbjct  1    MIISSSNDYREAAQRRLPPFLFHYIDGGAYSESTLKRNVEDLAHVALRQRVLKDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET+LFNETLSMP+ALSPVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEVTPAI
Sbjct  61   ETQLFNETLSMPLALSPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVTPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  QRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQS+MHP WAWDVGLLGRPHDLGNISKYLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQSVMHPHWAWDVGLLGRPHDLGNISKYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            LTILADSGIRNGLD+VRMLALGADSVM+GRAF+YALAAQGGQGVSNLLDL++KEMRVAMT
Sbjct  301  LTILADSGIRNGLDIVRMLALGADSVMIGRAFVYALAAQGGQGVSNLLDLLEKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNKLI  382
            LTG K IADI+ SCLVEMNK +
Sbjct  361  LTGVKRIADIDSSCLVEMNKAL  382


> N9AJJ2 L-lactate dehydrogenase [Acinetobacter soli NIPH 2899]
Length=384

 Score =  713 bits (1841),  Expect = 0.0
 Identities = 349/382 (91%), Positives = 371/382 (97%), Gaps = 0/382 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISSSNDYREAA+RRLPPFLFHYIDGGAY+E TLKRNVEDL+ +ALRQRVL DMS+LSL
Sbjct  1    MIISSSNDYREAAQRRLPPFLFHYIDGGAYSESTLKRNVEDLAHVALRQRVLKDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET+LFNETLSMP+ALSPVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEVTPAI
Sbjct  61   ETQLFNETLSMPLALSPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVTPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  QRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQS+MHP WAWDVGLLGRPHDLGNISKYLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQSVMHPHWAWDVGLLGRPHDLGNISKYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGV+SSA A+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSSAHALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            LTILADSGIRNGLD+VRMLALGADSVM+GRAF+YALAAQGGQGVSNLLDL++KEMRVAMT
Sbjct  301  LTILADSGIRNGLDIVRMLALGADSVMIGRAFVYALAAQGGQGVSNLLDLLEKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNKLI  382
            LTG K IADI+ SCLVEMNK +
Sbjct  361  LTGVKRIADIDSSCLVEMNKAL  382


> A0A1C4GS64 L-lactate dehydrogenase [Acinetobacter albensis]
Length=384

 Score =  709 bits (1830),  Expect = 0.0
 Identities = 350/380 (92%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS+NDYREAAKRRLPPFLFHYIDGGAYAE+TLKRNVEDLS+IALRQRVLNDMSSLSL
Sbjct  1    MIISSTNDYREAAKRRLPPFLFHYIDGGAYAEHTLKRNVEDLSKIALRQRVLNDMSSLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET+LFNETLSMPVAL+PVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEV P I
Sbjct  61   ETQLFNETLSMPVALAPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVAPVI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQSMMHPQWAWDVGL GRPHDLGNISKYLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQSMMHPQWAWDVGLHGRPHDLGNISKYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGV+SSARA+P IAEAVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSSARALPPIAEAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRMLALGAD+ MLGRAFIYAL A GG GVSNLLDLI+KEMRVAMT
Sbjct  301  IKILADSGIRNGLDVVRMLALGADTCMLGRAFIYALGAAGGAGVSNLLDLIEKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAKTIADIN  CLV++++
Sbjct  361  LTGAKTIADINSDCLVKLDR  380


> A0A0M5JJY5 L-lactate dehydrogenase [Acinetobacter sp. TTH0-4]
Length=384

 Score =  707 bits (1826),  Expect = 0.0
 Identities = 349/380 (92%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS+NDYREAAKRRLPPFLFHYIDGGAYAE+TLKRNVEDLS+IALRQRVLNDMSSLSL
Sbjct  1    MIISSANDYREAAKRRLPPFLFHYIDGGAYAEHTLKRNVEDLSKIALRQRVLNDMSSLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET+LFNETLSMPVAL+PVGLTGMYARRGEVQAAVAAD+KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETQLFNETLSMPVALAPVGLTGMYARRGEVQAAVAADQKGIPFTLSTVSVCPIEEVAPVI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQSMMHPQWAWDVGL GRPHDLGNISKYLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQSMMHPQWAWDVGLHGRPHDLGNISKYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGV+SSARA+P IAEAVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSSARALPPIAEAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRMLALGAD+ MLGRAFIYAL A GG GVSNLLDLI+KEMRVAMT
Sbjct  301  IKILADSGIRNGLDVVRMLALGADTCMLGRAFIYALGAAGGAGVSNLLDLIEKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAKTIADIN  CLV++++
Sbjct  361  LTGAKTIADINSDCLVKLDR  380


> A0A1Y3CHL4 L-lactate dehydrogenase [Acinetobacter sp. ANC 4999]
Length=384

 Score =  707 bits (1824),  Expect = 0.0
 Identities = 347/380 (91%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS+NDYREAA+RRLPPFLFHYIDGGA AEYTL+RNVEDLS+IALRQRVLNDMS LSL
Sbjct  1    MIISSANDYREAARRRLPPFLFHYIDGGANAEYTLQRNVEDLSKIALRQRVLNDMSQLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLF+ETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETKLFDETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY+QS MHP WAW+VGLLGRPHDLGNISKYLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYMQSCMHPHWAWNVGLLGRPHDLGNISKYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGV+SSARA+P IA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSSARALPPIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + IL DSGIRNGLDVVRMLA+GAD+ MLGRAF+YALAA GG+GVSNLLDLIDKEMRVAMT
Sbjct  301  IKILVDSGIRNGLDVVRMLAMGADTCMLGRAFVYALAAAGGEGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAKTIADIN  CLV++NK
Sbjct  361  LTGAKTIADINSDCLVKLNK  380


> A0A172PZC2 L-lactate dehydrogenase [Acinetobacter baumannii]
Length=383

 Score =  705 bits (1820),  Expect = 0.0
 Identities = 346/380 (91%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS NDYR AA+RRLPPFLFHYIDGGAYAEYTLKRNV+DLS+IALRQRVLNDMS+LSL
Sbjct  1    MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEIALRQRVLNDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVAL+PVGLTGMYARRGEVQAA+AADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY+QS+ HP W+W+VGL+GRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            L ILADSGIRNGLDVVRMLALGADSV+LGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LAILADSGIRNGLDVVRMLALGADSVLLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAK+I+DIN  CLV+  K
Sbjct  361  LTGAKSISDINTDCLVQAIK  380


> I1SLB1 L-lactate dehydrogenase [Pseudomonas stutzeri]
Length=391

 Score =  637 bits (1644),  Expect = 0.0
 Identities = 314/376 (84%), Positives = 343/376 (91%), Gaps = 0/376 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+S DYR AAKR+LPPFLFHY+DGGAYAE+TL+RNVEDL+ IALRQRVL +MS LSL
Sbjct  1    MIISASTDYRAAAKRKLPPFLFHYVDGGAYAEHTLRRNVEDLASIALRQRVLRNMSELSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET+LF ETLSMPVAL+PVGLTGM ARRGEVQAA AADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETQLFGETLSMPVALAPVGLTGMLARRGEVQAARAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVL+DRGFMKNALERAKAAG +TLVFTVDMP PGARYRDAHSGMSGPNA++R
Sbjct  121  KRPMWFQLYVLKDRGFMKNALERAKAAGVTTLVFTVDMPTPGARYRDAHSGMSGPNASVR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            R LQ+M HP WAWDVGL G+PHDLGNI+ Y G TTGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RILQAMAHPLWAWDVGLHGKPHDLGNITTYRGHTTGLEDYIGWLAANFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILD EDA+DAV FGADGI+VSNHGGRQLDGVMSSARAMPAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDAEDARDAVTFGADGIIVSNHGGRQLDGVMSSARAMPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            L ILADSGIRNGLDVVRM+ALGAD+V+LGRAF YALA  G  GV+NLLDLI+KEMRVAM 
Sbjct  301  LKILADSGIRNGLDVVRMIALGADTVLLGRAFAYALAVDGEAGVTNLLDLIEKEMRVAMV  360

Query  361  LTGAKTIADINESCLV  376
            LTG KTI++I+   LV
Sbjct  361  LTGTKTISEISADSLV  376


> Q51135 Alpha-hydroxy-acid oxidizing protein [Neisseria meningitidis]
Length=390

 Score =  326 bits (836),  Expect = 3e-111
 Identities = 162/369 (44%), Positives = 229/369 (62%), Gaps = 2/369 (1%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            D R  AKR++P   + YID G++ E T + N  D   I  RQ+VL +M   SLETK+  +
Sbjct  13   DLRRVAKRKMPRMFYDYIDSGSWTETTYRENTSDFKDIRFRQKVLVNMEGRSLETKMIGQ  72

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
             + MPVA++P G TGM    GE+ AA AA+K GIPFT+ST+S+C IE+V      P WFQ
Sbjct  73   DVKMPVAIAPTGFTGMAHADGEILAARAAEKFGIPFTLSTMSICSIEDVAENTSAPFWFQ  132

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSG-PNAAMRRYLQSM  186
            LYV+RDR FM+N ++RAK A CS LV T D+ V G R++D  +G+S  P   +   +   
Sbjct  133  LYVMRDREFMENLIKRAKDAKCSALVLTADLQVLGQRHKDIKNGLSAPPKPTIANLINLA  192

Query  187  MHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDG  246
              P+W   + L        NI  +      L    SW    FDP +SW D+  I++ W G
Sbjct  193  TKPEWCMKM-LNTERRTFRNIVGHAKNVGDLSSLSSWTSEQFDPRLSWDDVARIKDLWGG  251

Query  247  PMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTILAD  306
             ++IKGI++PEDA+ A + GAD ++VSNHGGRQLD  +S+ +A+P I  AV  D+ +  D
Sbjct  252  KLIIKGIMEPEDAEKAAKSGADALIVSNHGGRQLDDTVSAIKALPDIVSAVGSDIEVWMD  311

Query  307  SGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAKT  366
            SGIR+G D+++  ALGA   M+GRAF+Y L A G +GV+  L+++ KEM ++M  TG + 
Sbjct  312  SGIRSGQDILKAWALGAKGTMIGRAFLYGLGAYGEEGVTRALEILYKEMDISMAFTGHRD  371

Query  367  IADINESCL  375
            I D++ S L
Sbjct  372  IQDVDASIL  380


> Q9X4F0 Alpha-hydroxy-acid oxidizing protein [Rhodobacter sphaeroides]
Length=387

 Score =  309 bits (791),  Expect = 1e-104
 Identities = 157/370 (42%), Positives = 227/370 (61%), Gaps = 8/370 (2%)

Query  2    IISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLE  61
            +I+   D +   +RR P   F Y + G+Y E T + N  D  +I LRQ+V  DM   S  
Sbjct  3    VITCIEDLKRMHRRRAPRMFFDYCESGSYTEQTFRDNCSDFQKIRLRQKVAVDMLGRSTR  62

Query  62   TKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIK  121
            +++  E ++MPVAL+PVG+TGM    GE++AA AA+  G+P+T+ST+S+C +E+V  A  
Sbjct  63   SEMIGEPVAMPVALAPVGMTGMQCADGEIKAARAAEAFGVPYTLSTMSICSVEDVAAATT  122

Query  122  RPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRR  181
            +P WFQLYV++D  F+   LER K AGCS LV T+D+ + G R++D  +G+S P   M  
Sbjct  123  KPFWFQLYVMKDEEFVDGMLERVKKAGCSALVLTLDLQILGQRHKDLRNGLSAP-PKMTL  181

Query  182  YLQSMMHPQWAWDVGLL-GRPHDLGNI---SKYLGKTTGLEDYISWLGSNFDPSISWKDL  237
             +   +  +W W + +L       GNI   +K +G T+ L    SW    FDP + W  +
Sbjct  182  PVMLDLATKWGWGLEMLKTHRRSFGNIVGHAKGVGDTSSL---ASWTAEQFDPQLDWGKI  238

Query  238  EWIREFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAV  297
              +R+ W G +++KGILD EDA+ A  FGAD I+VSNHGGRQLDG +SS R +P I  AV
Sbjct  239  ARLRDKWGGKLILKGILDEEDARRAADFGADAIIVSNHGGRQLDGALSSIRMLPPIVRAV  298

Query  298  KGDLTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRV  357
               + I  D GIR+G DV++ LA+GA    +GR++IY L A G  GV   L++I KE+ +
Sbjct  299  GDQVEIHMDGGIRSGQDVLKALAMGAKGTFIGRSYIYGLGAMGEAGVRRALEVIWKELDI  358

Query  358  AMTLTGAKTI  367
            +M L G K +
Sbjct  359  SMALCGEKDV  368


> I6TUB3 Hydroxymandelate oxidase [Streptomyces parvus]
Length=371

 Score =  242 bits (617),  Expect = 8e-79
 Identities = 144/356 (40%), Positives = 201/356 (56%), Gaps = 20/356 (6%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            D R  A+  L P ++ +++GG+  E  +  N    +++AL  RVL  ++     T+L   
Sbjct  17   DVRAHARAVLEPGIWDFVEGGSGTERVMAANRAAFAEVALVPRVLTGVAEADPRTRLLGG  76

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
              +MPVA++P+    +    GE+ AA AA   G+PF +ST+S   +E+V  A     WFQ
Sbjct  77   HAAMPVAVAPMAYQRLLHDDGELAAARAARAAGVPFVVSTLSSHRVEDVA-ATGATTWFQ  135

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRRYLQSMM  187
            LY LRDR      + RA+AAGC  L+ TVD+P+ G R RD  +G   P       L S  
Sbjct  136  LYCLRDRAKNHELVARAEAAGCGALMVTVDVPLMGRRLRDVRNGFVLPRHVRAANLDS--  193

Query  188  HPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDGP  247
                    G     H      +  G  + L  + S   + F P ++W+DL  +R+    P
Sbjct  194  --------GPATEAH------RRFGGDSALAVHTS---AAFAPGLTWRDLAELRDRTSLP  236

Query  248  MVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTILADS  307
            +V+KGILDP DA+ AV  GAD +VVSNHGGRQLDG + S RA+PA+AEAV G   +L DS
Sbjct  237  LVVKGILDPRDARSAVEAGADAVVVSNHGGRQLDGAVPSVRALPAVAEAVGGACEVLLDS  296

Query  308  GIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTG  363
            G+R G DV+R LALGA  V+LGR  ++ LAA G +GV  +LDL+  E+   MTL G
Sbjct  297  GVRGGTDVLRALALGARGVLLGRPVLWGLAAGGRRGVEQVLDLVRTELGQGMTLAG  352


> A0A2P2CL53 2-hydroxy-acid oxidase [Streptomyces sp. CNB091]
Length=367

 Score =  240 bits (613),  Expect = 3e-78
 Identities = 142/361 (39%), Positives = 198/361 (55%), Gaps = 19/361 (5%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            D   AA+  L P ++ ++ GG+  E TL  N   L +IAL  R L   ++ S    +  E
Sbjct  13   DVERAAREALSPDVWDFVAGGSGGELTLAANRTALDRIALVPRALTGCTAASPGCTVLGE  72

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
               MP A++P+    +    GEV AA AA   G+ + +ST+S  P++ +T    R  WFQ
Sbjct  73   PWPMPAAVAPMAYQRLLHPEGEVAAARAAAATGVTYVISTMSSTPLDRITATGART-WFQ  131

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRRYLQSMM  187
            LY LR+R    + + RA+ AGC  LV TVD+PV G R RDA +G + P +          
Sbjct  132  LYWLRERARTADLVHRAEQAGCRALVLTVDVPVMGRRLRDARNGFALPGSVT--------  183

Query  188  HPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDGP  247
                     LLG   D        G  + +  + S +   FDP + W+D+ W+R     P
Sbjct  184  -------AALLGDGPDSATAHTPDGTGSAVARHTSAV---FDPGLGWQDIAWLRGITSLP  233

Query  248  MVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTILADS  307
            + +KG+L P+DA+ A   G D +VVSNHGGRQLDG +SSA A+PA+  AV G L +L DS
Sbjct  234  LALKGVLSPDDARRAADAGVDLLVVSNHGGRQLDGAISSADALPAVTAAVAGRLPVLLDS  293

Query  308  GIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAKTI  367
            G+R+G DV+R LALGA  V+LGR  ++ LAA G  GV  +LD +  E+  AM L G  T 
Sbjct  294  GVRDGTDVLRALALGASGVLLGRPVLWGLAADGEAGVRTVLDQVRDELEHAMLLAGCPTP  353

Query  368  A  368
            A
Sbjct  354  A  354


> R9RKA7 S-mandelate dehydrogenase [Pseudomonas aeruginosa]
Length=393

 Score =  239 bits (609),  Expect = 2e-77
 Identities = 135/370 (36%), Positives = 210/370 (57%), Gaps = 9/370 (2%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            DYR+ A++RLP  ++ Y++GGA  EY +K N +   Q   + + L D+S  SL+ ++  +
Sbjct  10   DYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGK  69

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
              SMP+ + P GL G    +G++  A AA K GIPF +ST S   IE++       +WFQ
Sbjct  70   RQSMPLLIGPTGLNGALWPKGDLALAQAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQ  129

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGP-NAAMRRYLQSM  186
            LYV+  R   +  + +A  +G +TLV T D+ V G R RD H+    P +   +  L   
Sbjct  130  LYVIH-REIAQGMVLKALHSGYTTLVLTTDVAVNGYRERDLHNRFKMPMSYTPKVMLDGC  188

Query  187  MHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDG  246
            +HP+W+ D+   G P     +S    +T+ LE   + +    D S +W+ L W+R+ W  
Sbjct  189  LHPRWSLDLVRHGMPQLANFVS---SQTSSLEMQAALMSRQMDASFNWEALRWLRDLWPH  245

Query  247  PMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAV-KGDLTILA  305
             +++KG+L  EDA   +  GADG+++SNHGGRQLD  +S    M  +A++V K    +L 
Sbjct  246  KLLVKGLLSAEDADHCIAEGADGVILSNHGGRQLDCAVS---PMEVLAQSVAKTGKPVLI  302

Query  306  DSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAK  365
            DSG R G D+V+ LALGA++V+LGRA +Y LAA+G  GV  +L L+  ++   +   G  
Sbjct  303  DSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCP  362

Query  366  TIADINESCL  375
             I  ++   L
Sbjct  363  DITSLSPDYL  372


> A0A0P0KG57 Hydroxymandelate oxidase [Streptomyces sp. DSM 11171]
Length=379

 Score =  238 bits (607),  Expect = 3e-77
 Identities = 145/361 (40%), Positives = 203/361 (56%), Gaps = 21/361 (6%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            D+  AA   L   +  ++ GG+ AE TL  N   L ++ L  RVL D S +S E++L   
Sbjct  22   DFERAAAAVLSAEVRDFVAGGSGAETTLDANRAALDRVFLVPRVLTDASRVSTESRLLGR  81

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
            T +MPVA++PV    +    GE+ AA AA   G+PFT ST+S  PIEE+T A+   +WFQ
Sbjct  82   TAAMPVAVAPVAYHRLVHPDGELAAARAAKAAGVPFTASTLSSVPIEEIT-AVGGAVWFQ  140

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRRYLQSMM  187
            LY LRD       + RA+ AGC  +V TVD+P  G R RD  +  + P       L S  
Sbjct  141  LYWLRDTAQTMRLVRRAEDAGCEAVVLTVDVPWMGRRLRDVRNRFALPGHVTAANLTS--  198

Query  188  HPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDGP  247
             P  A       R  D+  ++ + G+T             F  +++W  +  +RE    P
Sbjct  199  GPSSAHR-----RAADVSAVAVHTGRT-------------FSSALTWSHVADLRERTGLP  240

Query  248  MVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTILADS  307
            +V+KG+L PEDA  A   GAD +VVSNHGGRQLDG + S  A+P +  AV+G   +L DS
Sbjct  241  LVLKGVLAPEDAVRAAESGADAVVVSNHGGRQLDGAVPSIEALPDVVRAVRGSCEVLLDS  300

Query  308  GIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAKTI  367
            GIR+G DV+R LALGA  V++GR  I+ LAA G  G + +L+L+  E+R A+ L+G   +
Sbjct  301  GIRSGTDVLRALALGASGVLVGRPLIWGLAAAGEAGAARVLELLADELRDALGLSGCDGV  360

Query  368  A  368
            A
Sbjct  361  A  361


> Q93N79 Glycolate oxidase [Streptomyces lavendulae]
Length=372

 Score =  238 bits (606),  Expect = 3e-77
 Identities = 138/365 (38%), Positives = 201/365 (55%), Gaps = 21/365 (6%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            D   AA   LPP ++ +I GG+  E +L  N      + +R R+L D+S    E+ L   
Sbjct  19   DVERAAAAALPPDVWDFIAGGSGRELSLAANRAAFDAVFVRPRILRDVSGCGAESTLLGR  78

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
             + MPVA+ PV    +    GE+  A AA   G+PFT++T+S  P+EEVT A+   +WFQ
Sbjct  79   AVRMPVAIGPVAYHRLVCPEGELATARAAKAAGVPFTLATLSSVPVEEVT-AVGGSVWFQ  137

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRRYLQSMM  187
            LY LRD G   + + R + AGC  +V TVD+P  G R RD  +G + P+     +L    
Sbjct  138  LYWLRDTGRTLDLVRRGEDAGCEAIVLTVDVPWMGRRLRDVRNGFALPDHVRAVHLG---  194

Query  188  HPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDGP  247
                    G     H  G+ +  +   T            F  S++W ++E +RE    P
Sbjct  195  --------GGASTAHRGGDGASAVAVHTA---------ETFSRSLTWSNVERLRECTRLP  237

Query  248  MVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTILADS  307
            +V+KG+L PEDA+ AV  G D + VSNHGGRQLDG +++  A+P + EAV G   IL D 
Sbjct  238  IVLKGVLAPEDARRAVEHGVDAVGVSNHGGRQLDGALTAVDALPEVVEAVGGTCEILLDG  297

Query  308  GIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAKTI  367
            G+R+G DV++ LALGA  V++GRA ++ LAA G  GV  +L+L+  E+  A+ L G   +
Sbjct  298  GVRSGTDVLKALALGASGVLVGRAPVWGLAAGGEDGVRQVLELLAAEVTDALGLAGCAGV  357

Query  368  ADINE  372
            A+  E
Sbjct  358  AEARE  362


> B5AEM8 L-lactate dehydrogenase [Mycobacterium lepromatosis]
Length=400

 Score =  238 bits (607),  Expect = 5e-77
 Identities = 134/376 (36%), Positives = 206/376 (55%), Gaps = 9/376 (2%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            D R  AK+R P   F Y DG A  E ++KR  +    I     +L D++++     +   
Sbjct  25   DLRRIAKQRTPKAAFDYTDGAAEDELSIKRAQQAFRDIEFHPAILRDVTNVCAGWDVLGH  84

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPM-WF  126
             + +P  ++P G T +    GE+  A AA   GIPF++ST++   IE+V  A+ +   WF
Sbjct  85   PVMLPFGIAPTGFTRLMHTEGEIAGAQAAAAAGIPFSLSTLATSAIEDVVAAVPQGRKWF  144

Query  127  QLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNA-AMRRYLQS  185
            QLY+ RDR      +ERA  AG   L+ TVD+PV GAR RD  +GMS P A  ++    +
Sbjct  145  QLYMWRDRERSMALVERAANAGYDALLVTVDVPVSGARLRDTRNGMSIPPALTLQTVFDA  204

Query  186  MMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWD  245
            + HP+W  D+ L   P    ++ ++ G  +       +L + FDPS+++ DL WI+  W 
Sbjct  205  LPHPRWWIDL-LTTEPLAFASLDRWSGTVS------EYLNTMFDPSVTFDDLAWIKAQWP  257

Query  246  GPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTILA  305
            G  V+KGI   +DA+  V  GADGIV+SNHGGRQLD        +P +A  +  D  IL 
Sbjct  258  GKFVVKGIQTLDDARAVVERGADGIVLSNHGGRQLDRAPVPFHLLPTVARELGKDTEILL  317

Query  306  DSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAK  365
            D+GI +G D+V  +ALGA   ++GRA++Y L A G  GV   ++++D  +   M L G  
Sbjct  318  DTGIMSGADIVAAIALGARCTLVGRAYLYGLMAGGEAGVRRAIEILDNGVIRTMRLLGVT  377

Query  366  TIADINESCLVEMNKL  381
             + ++    + ++ +L
Sbjct  378  CLEELLPRHVTQLQQL  393



Lambda      K        H        a         alpha
   0.322    0.136    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2124235


  Database: 8fa82d34b61095e4de3b9c91c1049880.TrEMBL.fasta
    Posted date:  Sep 28, 2020  2:06 PM
  Number of letters in database: 7,291
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40