ACIAD0108 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 7a7b5bbf047695621188a7e0f9d65e99.SwissProt.fasta
           36 sequences; 13,931 total letters



Query= ACIAD0108

Length=385
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FFS1 L-lactate dehydrogenase [Acinetobacter baylyi (strain AT...   764    0.0  
  B7IBS4 L-lactate dehydrogenase [Acinetobacter baumannii (strain...   704    0.0  
  B2I061 L-lactate dehydrogenase [Acinetobacter baumannii (strain...   704    0.0  
  B0VND0 L-lactate dehydrogenase [Acinetobacter baumannii (strain...   704    0.0  
  A3M0X0 L-lactate dehydrogenase [Acinetobacter baumannii (strain...   704    0.0  
  B0V6L1 L-lactate dehydrogenase [Acinetobacter baumannii (strain...   704    0.0  
  B5R5C7 L-lactate dehydrogenase [Salmonella enteritidis PT4 (str...   659    0.0  
  B5RGI4 L-lactate dehydrogenase [Salmonella gallinarum (strain 2...   659    0.0  
  Q8ZL61 L-lactate dehydrogenase [Salmonella typhimurium (strain ...   657    0.0  
  B5EXA8 L-lactate dehydrogenase [Salmonella agona (strain SL483)]     657    0.0  
  B5FLH2 L-lactate dehydrogenase [Salmonella dublin (strain CT_02...   657    0.0  
  B4SXA4 L-lactate dehydrogenase [Salmonella newport (strain SL254)]   657    0.0  
  A9MVJ5 L-lactate dehydrogenase [Salmonella paratyphi B (strain ...   657    0.0  
  A9MLC3 L-lactate dehydrogenase [Salmonella arizonae (strain ATC...   657    0.0  
  C0Q1T7 L-lactate dehydrogenase [Salmonella paratyphi C (strain ...   657    0.0  
  B4TZU7 L-lactate dehydrogenase [Salmonella schwarzengrund (stra...   657    0.0  
  Q8Z2E5 L-lactate dehydrogenase [Salmonella typhi]                    657    0.0  
  B4T986 L-lactate dehydrogenase [Salmonella heidelberg (strain S...   656    0.0  
  Q5PLQ7 L-lactate dehydrogenase [Salmonella paratyphi A (strain ...   655    0.0  
  B5BHX7 L-lactate dehydrogenase [Salmonella paratyphi A (strain ...   655    0.0  
  Q57ID8 L-lactate dehydrogenase [Salmonella choleraesuis (strain...   653    0.0  
  A8ARJ1 L-lactate dehydrogenase [Citrobacter koseri (strain ATCC...   652    0.0  
  Q31V17 L-lactate dehydrogenase [Shigella boydii serotype 4 (str...   652    0.0  
  Q0SYD1 L-lactate dehydrogenase [Shigella flexneri serotype 5b (...   652    0.0  
  Q83PP7 L-lactate dehydrogenase [Shigella flexneri]                   652    0.0  
  Q3YVX0 L-lactate dehydrogenase [Shigella sonnei (strain Ss046)]      652    0.0  
  P33232 L-lactate dehydrogenase [Escherichia coli (strain K12)]       652    0.0  
  P20932 (S)-mandelate dehydrogenase [Pseudomonas putida]              235    9e-76
  Q9LJH5 Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 [Arabidopsis...   229    9e-74
  Q24JJ8 Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 [Arabidopsis...   225    3e-72
  Q8H3I4 Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 [Oryza sativ...   224    8e-72
  Q7FAS1 Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 [Oryza sativ...   223    2e-71
  O49506 Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Arabidopsis...   223    3e-71
  O52792 4-hydroxymandelate oxidase [Amycolatopsis orientalis]         221    7e-71
  P05414 Peroxisomal (S)-2-hydroxy-acid oxidase [Spinacia oleracea]    217    6e-69
  Q9UJM8 Hydroxyacid oxidase 1 [Homo sapiens]                          216    2e-68


> Q6FFS1 L-lactate dehydrogenase [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=384

 Score =  764 bits (1974),  Expect = 0.0
 Identities = 384/384 (100%), Positives = 384/384 (100%), Gaps = 0/384 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL
Sbjct  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI
Sbjct  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI
Sbjct  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNKLIQS  384
            LTGAKTIADINESCLVEMNKLIQS
Sbjct  361  LTGAKTIADINESCLVEMNKLIQS  384


> B7IBS4 L-lactate dehydrogenase [Acinetobacter baumannii (strain 
AB0057)]
Length=383

 Score =  704 bits (1817),  Expect = 0.0
 Identities = 345/380 (91%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS NDYR AA+RRLPPFLFHYIDGGAYAEYTLKRNV+DLS+IALRQRVLNDMS+LSL
Sbjct  1    MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEIALRQRVLNDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVAL+PVGLTGMYARRGEVQAA+AADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY+QS+ HP W+W+VGL+GRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            L ILADSGIRNGLDVVRMLALGAD+V+LGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAK+I+DIN  CLV+  K
Sbjct  361  LTGAKSISDINADCLVQAIK  380


> B2I061 L-lactate dehydrogenase [Acinetobacter baumannii (strain 
ACICU)]
Length=383

 Score =  704 bits (1817),  Expect = 0.0
 Identities = 345/380 (91%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS NDYR AA+RRLPPFLFHYIDGGAYAEYTLKRNV+DLS+IALRQRVLNDMS+LSL
Sbjct  1    MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEIALRQRVLNDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVAL+PVGLTGMYARRGEVQAA+AADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY+QS+ HP W+W+VGL+GRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            L ILADSGIRNGLDVVRMLALGAD+V+LGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAK+I+DIN  CLV+  K
Sbjct  361  LTGAKSISDINADCLVQAIK  380


> B0VND0 L-lactate dehydrogenase [Acinetobacter baumannii (strain 
SDF)]
Length=383

 Score =  704 bits (1817),  Expect = 0.0
 Identities = 345/380 (91%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS NDYR AA+RRLPPFLFHYIDGGAYAEYTLKRNV+DLS+IALRQRVLNDMS+LSL
Sbjct  1    MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEIALRQRVLNDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVAL+PVGLTGMYARRGEVQAA+AADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY+QS+ HP W+W+VGL+GRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            L ILADSGIRNGLDVVRMLALGAD+V+LGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAK+I+DIN  CLV+  K
Sbjct  361  LTGAKSISDINTDCLVQAIK  380


> A3M0X0 L-lactate dehydrogenase [Acinetobacter baumannii (strain 
ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)]
Length=383

 Score =  704 bits (1817),  Expect = 0.0
 Identities = 345/380 (91%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS NDYR AA+RRLPPFLFHYIDGGAYAEYTLKRNV+DLS+IALRQRVLNDMS+LSL
Sbjct  1    MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEIALRQRVLNDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVAL+PVGLTGMYARRGEVQAA+AADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY+QS+ HP W+W+VGL+GRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            L ILADSGIRNGLDVVRMLALGAD+V+LGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAK+I+DIN  CLV+  K
Sbjct  361  LTGAKSISDINADCLVQAIK  380


> B0V6L1 L-lactate dehydrogenase [Acinetobacter baumannii (strain 
AYE)]
Length=383

 Score =  704 bits (1817),  Expect = 0.0
 Identities = 345/380 (91%), Positives = 366/380 (96%), Gaps = 0/380 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIISS NDYR AA+RRLPPFLFHYIDGGAYAEYTLKRNV+DLS+IALRQRVLNDMS+LSL
Sbjct  1    MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEIALRQRVLNDMSALSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ETKLFNETLSMPVAL+PVGLTGMYARRGEVQAA+AADKKGIPFT+STVSVCPIEEV PAI
Sbjct  61   ETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR
Sbjct  121  NRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY+QS+ HP W+W+VGL+GRPHDLGNISKYLGK TGLEDYI WLGSNFDPSISWKDLEWI
Sbjct  181  RYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIGWLGSNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            L ILADSGIRNGLDVVRMLALGAD+V+LGRAF+YALAA GGQGVSNLLDLIDKEMRVAMT
Sbjct  301  LAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGGQGVSNLLDLIDKEMRVAMT  360

Query  361  LTGAKTIADINESCLVEMNK  380
            LTGAK+I+DIN  CLV+  K
Sbjct  361  LTGAKSISDINADCLVQAIK  380


> B5R5C7 L-lactate dehydrogenase [Salmonella enteritidis PT4 (strain 
P125109)]
Length=396

 Score =  659 bits (1700),  Expect = 0.0
 Identities = 321/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAKTI++I+   LV+
Sbjct  361  LTGAKTISEISGDSLVQ  377


> B5RGI4 L-lactate dehydrogenase [Salmonella gallinarum (strain 
287/91 / NCTC 13346)]
Length=396

 Score =  659 bits (1700),  Expect = 0.0
 Identities = 321/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAKTI++I+   LV+
Sbjct  361  LTGAKTISEISGDSLVQ  377


> Q8ZL61 L-lactate dehydrogenase [Salmonella typhimurium (strain 
LT2 / SGSC1412 / ATCC 700720)]
Length=396

 Score =  657 bits (1696),  Expect = 0.0
 Identities = 320/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> B5EXA8 L-lactate dehydrogenase [Salmonella agona (strain SL483)]
Length=396

 Score =  657 bits (1696),  Expect = 0.0
 Identities = 320/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> B5FLH2 L-lactate dehydrogenase [Salmonella dublin (strain CT_02021853)]
Length=396

 Score =  657 bits (1696),  Expect = 0.0
 Identities = 320/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> B4SXA4 L-lactate dehydrogenase [Salmonella newport (strain SL254)]
Length=396

 Score =  657 bits (1696),  Expect = 0.0
 Identities = 320/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETPLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> A9MVJ5 L-lactate dehydrogenase [Salmonella paratyphi B (strain 
ATCC BAA-1250 / SPB7)]
Length=396

 Score =  657 bits (1696),  Expect = 0.0
 Identities = 320/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> A9MLC3 L-lactate dehydrogenase [Salmonella arizonae (strain ATCC 
BAA-731 / CDC346-86 / RSK2980)]
Length=396

 Score =  657 bits (1694),  Expect = 0.0
 Identities = 319/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P +
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTL  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> C0Q1T7 L-lactate dehydrogenase [Salmonella paratyphi C (strain 
RKS4594)]
Length=396

 Score =  657 bits (1694),  Expect = 0.0
 Identities = 319/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  QRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKG+LDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGLLDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAKTI++I+   LV+
Sbjct  361  LTGAKTISEISGDSLVQ  377


> B4TZU7 L-lactate dehydrogenase [Salmonella schwarzengrund (strain 
CVM19633)]
Length=396

 Score =  657 bits (1694),  Expect = 0.0
 Identities = 319/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P +
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTL  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> Q8Z2E5 L-lactate dehydrogenase [Salmonella typhi]
Length=396

 Score =  657 bits (1694),  Expect = 0.0
 Identities = 319/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISATSDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P +
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTL  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKTGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> B4T986 L-lactate dehydrogenase [Salmonella heidelberg (strain 
SL476)]
Length=396

 Score =  656 bits (1692),  Expect = 0.0
 Identities = 319/377 (85%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  QRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> Q5PLQ7 L-lactate dehydrogenase [Salmonella paratyphi A (strain 
ATCC 9150 / SARB42)]
Length=396

 Score =  655 bits (1691),  Expect = 0.0
 Identities = 318/377 (84%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  QRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDL++KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLVEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> B5BHX7 L-lactate dehydrogenase [Salmonella paratyphi A (strain 
AKU_12601)]
Length=396

 Score =  655 bits (1691),  Expect = 0.0
 Identities = 318/377 (84%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETLSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  QRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDL++KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLVEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISGDSLVQ  377


> Q57ID8 L-lactate dehydrogenase [Salmonella choleraesuis (strain 
SC-B67)]
Length=396

 Score =  653 bits (1684),  Expect = 0.0
 Identities = 318/377 (84%), Positives = 350/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLSQ+ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRTLPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNETL MPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNETLPMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            +RPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAM 
Sbjct  121  QRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAML  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q++MHP+WAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGKAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAKTI++I+   LV+
Sbjct  361  LTGAKTISEISGDSLVQ  377


> A8ARJ1 L-lactate dehydrogenase [Citrobacter koseri (strain ATCC 
BAA-895 / CDC 4225-83 / SGSC4696)]
Length=396

 Score =  652 bits (1683),  Expect = 0.0
 Identities = 318/377 (84%), Positives = 349/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHYIDGGAYAEYTL+RNVEDLS++ALRQRVL +MS LSL
Sbjct  1    MIISAASDYRAAAQRILPPFLFHYIDGGAYAEYTLRRNVEDLSEVALRQRVLKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNE LSMPVAL+PVGL GMYARRGEVQAA AAD KGIPFT+STVSVCPIEEV P I
Sbjct  61   ETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAA+R
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAALR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RY Q+  HPQWAWDVGL GRPHDLGNIS YLGK TGLEDYI WL +NFDPSISWKDLEWI
Sbjct  181  RYWQAATHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            REFWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGADSV+LGRA++YALA  G  GV+NLLDLI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADSVLLGRAYLYALATAGQAGVANLLDLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I+   LV+
Sbjct  361  LTGAKSISEISRDSLVQ  377


 Score = 18.9 bits (37),  Expect = 8.9
 Identities = 12/59 (20%), Positives = 26/59 (44%), Gaps = 0/59 (0%)

Query  20   FLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNETLSMPVALSPV  78
            +L+     G      L   +E   ++A+       +S +S ++ +     S+P AL+P+
Sbjct  332  YLYALATAGQAGVANLLDLIEKEMKVAMTLTGAKSISEISRDSLVQELGKSLPAALAPL  390


> Q31V17 L-lactate dehydrogenase [Shigella boydii serotype 4 (strain 
Sb227)]
Length=396

 Score =  652 bits (1682),  Expect = 0.0
 Identities = 316/377 (84%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHY+DGGAY+EYTL+RNVEDLS++ALRQR+L +MS LSL
Sbjct  1    MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNE LSMPVAL+PVGL GMYARRGEVQAA AAD  GIPFT+STVSVCPIEEV PAI
Sbjct  61   ETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADTHGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGL GRPHDLGNIS YLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRAF+YALA  G  GV+NLL+LI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I +  LV+
Sbjct  361  LTGAKSISEITQDSLVQ  377


> Q0SYD1 L-lactate dehydrogenase [Shigella flexneri serotype 5b 
(strain 8401)]
Length=396

 Score =  652 bits (1682),  Expect = 0.0
 Identities = 316/377 (84%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHY+DGGAY+EYTL+RNVEDLS++ALRQR+L +MS LSL
Sbjct  1    MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNE LSMPVAL+PVGL GMYARRGEVQAA AAD  GIPFT+STVSVCPIEEV PAI
Sbjct  61   ETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGL GRPHDLGNIS YLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRAF+YALA  G  GV+NLL+LI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I +  LV+
Sbjct  361  LTGAKSISEITQDSLVQ  377


> Q83PP7 L-lactate dehydrogenase [Shigella flexneri]
Length=396

 Score =  652 bits (1682),  Expect = 0.0
 Identities = 316/377 (84%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHY+DGGAY+EYTL+RNVEDLS++ALRQR+L +MS LSL
Sbjct  1    MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNE LSMPVAL+PVGL GMYARRGEVQAA AAD  GIPFT+STVSVCPIEEV PAI
Sbjct  61   ETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGL GRPHDLGNIS YLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRAF+YALA  G  GV+NLL+LI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I +  LV+
Sbjct  361  LTGAKSISEITQDSLVQ  377


> Q3YVX0 L-lactate dehydrogenase [Shigella sonnei (strain Ss046)]
Length=396

 Score =  652 bits (1682),  Expect = 0.0
 Identities = 316/377 (84%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHY+DGGAY+EYTL+RNVEDLS++ALRQR+L +MS LSL
Sbjct  1    MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNE LSMPVAL+PVGL GMYARRGEVQAA AAD  GIPFT+STVSVCPIEEV PAI
Sbjct  61   ETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGL GRPHDLGNIS YLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRAF+YALA  G  GV+NLL+LI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I +  LV+
Sbjct  361  LTGAKSISEITQDSLVQ  377


> P33232 L-lactate dehydrogenase [Escherichia coli (strain K12)]
Length=396

 Score =  652 bits (1682),  Expect = 0.0
 Identities = 316/377 (84%), Positives = 352/377 (93%), Gaps = 0/377 (0%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            MIIS+++DYR AA+R LPPFLFHY+DGGAY+EYTL+RNVEDLS++ALRQR+L +MS LSL
Sbjct  1    MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSL  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            ET LFNE LSMPVAL+PVGL GMYARRGEVQAA AAD  GIPFT+STVSVCPIEEV PAI
Sbjct  61   ETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAI  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
            KRPMWFQLYVLRDRGFM+NALERAKAAGCSTLVFTVDMP PGARYRDAHSGMSGPNAAMR
Sbjct  121  KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            RYLQ++ HPQWAWDVGL GRPHDLGNIS YLGK TGLEDYI WLG+NFDPSISWKDLEWI
Sbjct  181  RYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI  240

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R+FWDGPMVIKGILDPEDA+DAVRFGADGIVVSNHGGRQLDGV+SSARA+PAIA+AVKGD
Sbjct  241  RDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD  300

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + ILADSGIRNGLDVVRM+ALGAD+V+LGRAF+YALA  G  GV+NLL+LI+KEM+VAMT
Sbjct  301  IAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMT  360

Query  361  LTGAKTIADINESCLVE  377
            LTGAK+I++I +  LV+
Sbjct  361  LTGAKSISEITQDSLVQ  377


> P20932 (S)-mandelate dehydrogenase [Pseudomonas putida]
Length=393

 Score =  235 bits (600),  Expect = 9e-76
 Identities = 134/370 (36%), Positives = 208/370 (56%), Gaps = 9/370 (2%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            DYR+  ++RLP  ++ Y++GGA  EY +K N +   Q   + + L D+S  SL+ ++  +
Sbjct  10   DYRKLRQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGK  69

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
              SMP+ + P GL G    +G++  A AA K GIPF +ST S   IE++       +WFQ
Sbjct  70   RQSMPLLIGPTGLNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQ  129

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGP-NAAMRRYLQSM  186
            LYV+  R   +  + +A   G +TLV T D+ V G R RD H+    P + + +  L   
Sbjct  130  LYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNRFKIPMSYSAKVVLDGC  188

Query  187  MHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDG  246
            +HP+W+ D    G P     +S    +T+ LE   + +    D S +W+ L W+R+ W  
Sbjct  189  LHPRWSLDFVRHGMPQLANFVS---SQTSSLEMQAALMSRQMDASFNWEALRWLRDLWPH  245

Query  247  PMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAV-KGDLTILA  305
             +++KG+L  EDA   +  GADG+++SNHGGRQLD  +S    M  +A++V K    +L 
Sbjct  246  KLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAIS---PMEVLAQSVAKTGKPVLI  302

Query  306  DSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAK  365
            DSG R G D+V+ LALGA++V+LGRA +Y LAA+G  GV  +L L+  ++   +   G  
Sbjct  303  DSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCP  362

Query  366  TIADINESCL  375
             I  ++   L
Sbjct  363  DITSLSPDYL  372


> Q9LJH5 Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 [Arabidopsis 
thaliana]
Length=363

 Score =  229 bits (584),  Expect = 9e-74
 Identities = 132/382 (35%), Positives = 206/382 (54%), Gaps = 24/382 (6%)

Query  3    ISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLET  62
            I + ++++E AK+ LP   + + +GGA  ++TL  NV+   +I  R RVL D+S++ + T
Sbjct  4    IVNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSNIDMST  63

Query  63   KLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKR  122
             +    +S P+ ++P  +  +   +GE+  A AA        +S +S C IEEV  +   
Sbjct  64   SMLGYPISAPIMIAPTAMHKLAHPKGEIATAKAAAACNTIMIVSFMSTCTIEEVASSCNA  123

Query  123  PMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRRY  182
              + Q+YV + R      ++RA+ AG   +V TVD+P  G R  D  + M  P       
Sbjct  124  VRFLQIYVYKRRDVTAQIVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQLKNFEG  183

Query  183  LQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIRE  242
            L           V    RP++           +G+E + S   S FD S+SWKD+EW+R 
Sbjct  184  L-----------VSTEVRPNE----------GSGVEAFAS---SAFDASLSWKDIEWLRS  219

Query  243  FWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLT  302
                P+++KG+L  EDA  AV  G DGIVVSNHG RQLD   ++   +  +  AVKG + 
Sbjct  220  ITKLPILVKGLLTREDALKAVEAGVDGIVVSNHGARQLDYSPATITVLEEVVHAVKGRIP  279

Query  303  ILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLT  362
            +L D G+R G DV + LALGA +V++GR  +Y LAA+G  GV  ++D++  E  + M L+
Sbjct  280  VLLDGGVRRGTDVFKALALGAQAVLIGRPIVYGLAAKGEDGVKKVIDMLKNEFEITMALS  339

Query  363  GAKTIADINESCLVEMNKLIQS  384
            G  TI D+  + +   N+ I+S
Sbjct  340  GCPTIDDVTRNHVRTENERIKS  361


> Q24JJ8 Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 [Arabidopsis 
thaliana]
Length=363

 Score =  225 bits (574),  Expect = 3e-72
 Identities = 129/382 (34%), Positives = 200/382 (52%), Gaps = 24/382 (6%)

Query  3    ISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLET  62
            I + ++++E AK+ LP   + + +GGA  ++TL  NV+   +I  R RVL D+S + + T
Sbjct  4    IVNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSKIDMST  63

Query  63   KLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKR  122
            K+    +S P+ ++P G   +    GE   A AA        +S +S C  EE+  +   
Sbjct  64   KILGYPISAPIMIAPTGNHKLAHPEGETATAKAAAACNTIMIVSYMSSCTFEEIASSCNA  123

Query  123  PMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRRY  182
              + Q+YV + R      ++RA+ AG   +V TVD+P  G R  D  + M  P       
Sbjct  124  VRFLQIYVYKRRDITAQVVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQ------  177

Query  183  LQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIRE  242
                           L     L +      K +G++ + S     FD S SWKD+EW+R 
Sbjct  178  ---------------LKNFEGLFSTEVRPSKGSGVQAFAS---RAFDASFSWKDIEWLRS  219

Query  243  FWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLT  302
              + P+++KGIL  EDA  AV  G DGI+VSNHGGRQLD   ++   +  + + V+G + 
Sbjct  220  ITELPILVKGILTREDALKAVEAGVDGIIVSNHGGRQLDYSPATITVLEEVVQVVRGRIP  279

Query  303  ILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLT  362
            +L D G+R G DV + LALGA +V++GR  IY LAA+G  GV  ++D++  E  + M L+
Sbjct  280  VLLDGGVRRGTDVFKALALGAQAVLIGRPIIYGLAAKGEDGVKKVIDMLKNEFEITMALS  339

Query  363  GAKTIADINESCLVEMNKLIQS  384
            G  TI DI  + +   N+ + S
Sbjct  340  GCPTIDDITRNHVRTENERLHS  361


> Q8H3I4 Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 [Oryza sativa 
subsp. japonica]
Length=366

 Score =  224 bits (571),  Expect = 8e-72
 Identities = 131/377 (35%), Positives = 204/377 (54%), Gaps = 23/377 (6%)

Query  8    DYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFNE  67
            +Y+E AK+ LP   + YI+GGA  E+TL+ N+   ++I LR RVL D+S + + T L   
Sbjct  11   EYQELAKKALPKMAYDYINGGAEDEHTLRENIAAYTRIILRPRVLVDVSKIDMSTTLLGY  70

Query  68   TLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPMWFQ  127
            T+  P+ ++P G   +    GE   A AA        +S  S C IE+V  +     ++Q
Sbjct  71   TMRSPIIVAPTGGHKLAHPEGEKATARAAASCNAIMVLSFSSSCKIEDVASSCNAIRFYQ  130

Query  128  LYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRRYLQSMM  187
            LYV ++R      + RA++ G   L+ TVD P+ G R  D  + M  P +     L+ +M
Sbjct  131  LYVYKNRNVSATLVRRAESCGFKALLLTVDTPMLGRREADIRNKMVFPRSGN---LEGLM  187

Query  188  HPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFWDGP  247
                          HD  N S+       LE +     +  DPS+SWKD+EW++     P
Sbjct  188  TTD----------DHDTTNGSQ-------LERFAR---ATLDPSLSWKDIEWLKSITSMP  227

Query  248  MVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTILADS  307
            + +KGI+  EDA+ AV  G  G++VSNHG RQLD   ++  A+  +  AV G + +L D 
Sbjct  228  IFLKGIVTAEDARRAVEAGVAGVIVSNHGARQLDYAPATIAALEEVVRAVAGAVPVLVDG  287

Query  308  GIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGAKTI  367
            GIR G DV + LALGA +VM+GR   + LAA+G  G  +++++++ E+ VAM L G +++
Sbjct  288  GIRRGTDVFKALALGARAVMVGRPVFFGLAARGEAGARHVIEMLNGELEVAMALCGCRSV  347

Query  368  ADINESCLVEMNKLIQS  384
             +I  S ++     I+S
Sbjct  348  GEITRSHVMTEGDRIRS  364


> Q7FAS1 Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 [Oryza sativa 
subsp. japonica]
Length=367

 Score =  223 bits (569),  Expect = 2e-71
 Identities = 122/375 (33%), Positives = 206/375 (55%), Gaps = 21/375 (6%)

Query  2    IISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLE  61
            +I++ ++Y + AK++LP  ++ Y   GA  ++TLK N E  S+I  R R+L D+S +++ 
Sbjct  3    LITNVSEYEQLAKQKLPKMIYDYYASGAEDQWTLKENREAFSRILFRPRILIDVSRINMA  62

Query  62   TKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIK  121
            T +    +SMP+ ++P  +  M    GE+  A AA   G   T+S+ S   +EEV  A  
Sbjct  63   TNVLGFNISMPIMIAPSAMQKMAHPEGELATARAASAAGTIMTLSSWSTSSVEEVNSAAP  122

Query  122  RPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMRR  181
               +FQLYV +DR  ++  + RA+ AG   +  TVD P  G R  D  +  + P   + +
Sbjct  123  GIRFFQLYVYKDRNIVRQLVRRAELAGFKAIALTVDTPRLGRREADIKNRFNLPPHLVLK  182

Query  182  YLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIR  241
              +++       D+G + + +D           +GL  Y++   S  D S+SW D++W++
Sbjct  183  NFEAL-------DLGKMDKTND-----------SGLASYVA---SQVDRSLSWTDVKWLQ  221

Query  242  EFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDL  301
                 P+++KG++  ED + AV  GA GI+VSNHG RQLD V ++   +  +    KG L
Sbjct  222  TITSLPILVKGVMTAEDTRLAVESGAAGIIVSNHGARQLDYVPATISCLEEVVREAKGRL  281

Query  302  TILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTL  361
             +  D G+R G DV + LALGA  V +GR  +++LA  G  GV  +L ++  E+ + M L
Sbjct  282  PVFLDGGVRRGTDVFKALALGASGVFIGRPVLFSLAVDGEAGVRKVLQMLRDELELTMAL  341

Query  362  TGAKTIADINESCLV  376
            +G  ++A+I  + ++
Sbjct  342  SGCTSLAEITRNHVI  356


> O49506 Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Arabidopsis 
thaliana]
Length=368

 Score =  223 bits (567),  Expect = 3e-71
 Identities = 123/373 (33%), Positives = 202/373 (54%), Gaps = 21/373 (6%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            M I++  +Y + AK +LP  ++ Y   GA  ++TL+ N    S+I  R R+L D+S + +
Sbjct  1    MEITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDV  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
             T +    +SMP+ ++P  +  M    GE+  A A    G   T+S+ + C +EEV    
Sbjct  61   STTVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTG  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
                +FQLYV +DR  +   ++RA+ AG   +  TVD P  G R  D  +  + P     
Sbjct  121  PGIRFFQLYVYKDRNVVIQLVKRAEEAGFKAIALTVDTPRLGRRESDIKNRFALPRGLTL  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            +  + +                DLG I K     +GL  Y++      D S+SWKD++W+
Sbjct  181  KNFEGL----------------DLGKIDKT--NDSGLASYVA---GQVDQSLSWKDIKWL  219

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            +     P+++KG++  EDA+ AV +GA GI+VSNHG RQLD V ++  A+  + +AV+G 
Sbjct  220  QSITSLPILVKGVITAEDARIAVEYGAAGIIVSNHGARQLDYVPATIVALEEVVKAVEGR  279

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + +  D G+R G DV + LALGA  V +GR  +++LAA G  GV  +L ++  E  + M 
Sbjct  280  IPVFLDGGVRRGTDVFKALALGASGVFVGRPSLFSLAADGEAGVRKMLQMLRDEFELTMA  339

Query  361  LTGAKTIADINES  373
            L+G +++ +I+ +
Sbjct  340  LSGCRSLREISRT  352


> O52792 4-hydroxymandelate oxidase [Amycolatopsis orientalis]
Length=357

 Score =  221 bits (564),  Expect = 7e-71
 Identities = 135/367 (37%), Positives = 201/367 (55%), Gaps = 23/367 (6%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            M   S  D   AA+  LP  +F ++ GG+  E +L  N   L ++ +  R+L D++ ++ 
Sbjct  1    MTYVSLADLERAARDVLPGEIFDFLAGGSGTEASLVANRTALERVFVIPRMLRDLTDVTT  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
            E  +F    ++P+A++PV    ++   GE+  A AA   G+P+T+ T+S   +EE+    
Sbjct  61   EIDIFGRRAALPMAVAPVAYQRLFHPEGELAVARAARDAGVPYTICTLSSVSLEEIAAVG  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
             RP WFQLY LRD     + + RA+ AGC  +VFTVD+P  G R RD  +G +       
Sbjct  121  GRP-WFQLYWLRDEKRSLDLVRRAEDAGCEAIVFTVDVPWMGRRLRDMRNGFA-------  172

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
                    P+W           D G  +    +T G+          F P+ +W+ +E +
Sbjct  173  -------LPEWVTAANF-----DAGTAAHR--RTQGVSAVADHTAREFAPA-TWESVEAV  217

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            R   D P+V+KGIL  EDA+ AV  GA GIVVSNHGGRQLDG +     +  I  AV G 
Sbjct  218  RAHTDLPVVLKGILAVEDARRAVDAGAGGIVVSNHGGRQLDGAVPGIEMLGEIVAAVSGG  277

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
              +L D GIR+G DV++  ALGA +V++GR  ++ALAA G  GV  LL+L+ +E+R AM 
Sbjct  278  CEVLVDGGIRSGGDVLKATALGASAVLVGRPVMWALAAAGQDGVRQLLELLAEEVRDAMG  337

Query  361  LTGAKTI  367
            L G +++
Sbjct  338  LAGCESV  344


> P05414 Peroxisomal (S)-2-hydroxy-acid oxidase [Spinacia oleracea]
Length=369

 Score =  217 bits (552),  Expect = 6e-69
 Identities = 122/373 (33%), Positives = 199/373 (53%), Gaps = 21/373 (6%)

Query  1    MIISSSNDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSL  60
            M I++ N+Y   AK++LP  ++ Y   GA  ++TL  N    S+I  R R+L D++++ +
Sbjct  1    MEITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDM  60

Query  61   ETKLFNETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAI  120
             T +    +SMP+ ++P  +  M    GE   A AA   G   T+S+ +   +EEV    
Sbjct  61   TTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTG  120

Query  121  KRPMWFQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMSGPNAAMR  180
                +FQLYV +DR  +   + RA+ AG   +  TVD P  G R  D  +    P     
Sbjct  121  PGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTL  180

Query  181  RYLQSMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWI  240
            +  + +                DLG + K     +GL  Y++      D S+SWKD+ W+
Sbjct  181  KNFEGI----------------DLGKMDK--ANDSGLSSYVA---GQIDRSLSWKDVAWL  219

Query  241  REFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGD  300
            +     P+++KG++  EDA+ AV+ GA GI+VSNHG RQLD V ++  A+  + +A +G 
Sbjct  220  QTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGR  279

Query  301  LTILADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMT  360
            + +  D G+R G DV + LALGA  V +GR  +++LAA+G  GV  +L ++  E  + M 
Sbjct  280  IPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMA  339

Query  361  LTGAKTIADINES  373
            L+G +++ +I+ S
Sbjct  340  LSGCRSLKEISRS  352


> Q9UJM8 Hydroxyacid oxidase 1 [Homo sapiens]
Length=370

 Score =  216 bits (549),  Expect = 2e-68
 Identities = 129/380 (34%), Positives = 202/380 (53%), Gaps = 22/380 (6%)

Query  7    NDYREAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLSQIALRQRVLNDMSSLSLETKLFN  66
            NDY + AK  LP  ++ Y   GA  E TL  N+   S+  L  R+L +++   L T +  
Sbjct  9    NDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLG  68

Query  67   ETLSMPVALSPVGLTGMYARRGEVQAAVAADKKGIPFTMSTVSVCPIEEVTPAIKRPM-W  125
            + +SMP+ +    +  M    GE+    A    G    +S+ +   IEEV  A    + W
Sbjct  69   QRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRW  128

Query  126  FQLYVLRDRGFMKNALERAKAAGCSTLVFTVDMPVPGARYRDAHSGMS-GPNAAMRRYLQ  184
             QLY+ +DR   K  + +A+  G   +  TVD P  G R  D  +     P   M+ +  
Sbjct  129  LQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFET  188

Query  185  SMMHPQWAWDVGLLGRPHDLGNISKYLGKTTGLEDYISWLGSNFDPSISWKDLEWIREFW  244
            S +                  +  +  G  +GL  Y++      DPSISW+D++W+R   
Sbjct  189  STLS----------------FSPEENFGDDSGLAAYVA---KAIDPSISWEDIKWLRRLT  229

Query  245  DGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVMSSARAMPAIAEAVKGDLTIL  304
              P+V KGIL  +DA++AV+ G +GI+VSNHG RQLDGV ++   +P I EAV+G + + 
Sbjct  230  SLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVF  289

Query  305  ADSGIRNGLDVVRMLALGADSVMLGRAFIYALAAQGGQGVSNLLDLIDKEMRVAMTLTGA  364
             D G+R G DV++ LALGA +V +GR  ++ LA QG +GV ++L+++ +E R+AM L+G 
Sbjct  290  LDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGC  349

Query  365  KTIADINESCLVEMNKLIQS  384
            + +  I+++ LV  N L  S
Sbjct  350  QNVKVIDKT-LVRKNPLAVS  368



Lambda      K        H        a         alpha
   0.322    0.136    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3943830


  Database: 7a7b5bbf047695621188a7e0f9d65e99.SwissProt.fasta
    Posted date:  Sep 28, 2020  3:08 PM
  Number of letters in database: 13,931
  Number of sequences in database:  36



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40