ACIAD0102 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2729f81873f0b53d12221a8b2f1f73b6.TrEMBL.fasta
           23 sequences; 7,779 total letters



Query= ACIAD0102

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FFS7 UDP-glucose 4-epimerase [Acinetobacter baylyi (strain AT...   681    0.0   
  A0A0M1I335 UDP-glucose 4-epimerase [Acinetobacter sp. C15]           609    0.0   
  A0A1P8ELC6 UDP-glucose 4-epimerase [Acinetobacter soli]              608    0.0   
  N9BZR5 UDP-glucose 4-epimerase [Acinetobacter soli NIPH 2899]        606    0.0   
  A0A2S2FHA0 UDP-glucose 4-epimerase [Acinetobacter defluvii]          603    0.0   
  R9B8J3 UDP-glucose 4-epimerase [Acinetobacter tandoii DSM 14970...   603    0.0   
  A0A2L0HTZ2 UDP-glucose 4-epimerase [Acinetobacter sp. ACNIH2]        603    0.0   
  A0A178FZ19 UDP-glucose 4-epimerase [Acinetobacter sp. SFC]           599    0.0   
  A0A2C9WU24 UDP-glucose 4-epimerase [Acinetobacter sp. ANC 4655]      599    0.0   
  N9TMV5 UDP-glucose 4-epimerase [Acinetobacter sp. ANC 3880]          593    0.0   
  N9TDG6 UDP-glucose 4-epimerase [Acinetobacter sp. CIP 70.18]         592    0.0   
  N8XNC0 UDP-glucose 4-epimerase [Acinetobacter sp. CIP 56.2]          592    0.0   
  A0A2H9YPZ2 UDP-glucose 4-epimerase [Acinetobacter pseudolwoffii]     590    0.0   
  A0A0F7YYT2 UDP-glucose 4-epimerase [Acinetobacter baumannii AB5...   583    0.0   
  Q2QD27 UDP-glucose 4-epimerase [Aeromonas hydrophila]                400    2e-141
  A1Y9L8 UDP-glucose 4-epimerase [Aeromonas hydrophila]                380    9e-134
  O54385 UDP-glucose 4-epimerase [Brucella abortus]                    379    2e-133
  Q51148 UDP-glucose 4-epimerase [Neisseria meningitidis]              376    3e-132
  F8RC15 UDP-glucose 4-epimerase [Providencia alcalifaciens]           375    6e-132
  M9P0X5 UDP-glucose 4-epimerase [Providencia alcalifaciens]           375    9e-132
  Q9X3S6 UDP-glucose 4-epimerase [Neisseria meningitidis]              375    1e-131
  Q5ND78 UDP-glucose 4-epimerase [Yersinia sp. A125 KOH2]              370    1e-129
  Q937X4 UDP-glucose 4-epimerase [Edwardsiella ictaluri]               369    2e-129


> Q6FFS7 UDP-glucose 4-epimerase [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=339

 Score =  681 bits (1756),  Expect = 0.0
 Identities = 339/339 (100%), Positives = 339/339 (100%), Gaps = 0/339 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL
Sbjct  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN
Sbjct  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL
Sbjct  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS
Sbjct  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
            FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN
Sbjct  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339


> A0A0M1I335 UDP-glucose 4-epimerase [Acinetobacter sp. C15]
Length=337

 Score =  609 bits (1570),  Expect = 0.0
 Identities = 298/337 (88%), Positives = 315/337 (93%), Gaps = 0/337 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELL A+H VVV+DNLSNSS EAL RV+ L GKSL+FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLQAHHDVVVLDNLSNSSREALVRVEALAGKSLEFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RDS +LDQVF Q+ IDAVIHFAGLKAVGESQQIPL YFDNNIAGSI LV AM RAGVFKL
Sbjct  61   RDSQMLDQVFKQFQIDAVIHFAGLKAVGESQQIPLTYFDNNIAGSIHLVDAMARAGVFKL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEAN+SPLNEDMPTGMPSNNYGYTKLIVEQML+KLA+AD RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANSSPLNEDMPTGMPSNNYGYTKLIVEQMLQKLALADARWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH SG+IGEDPQGIPNNLMPYVTQVAVGRR+KLSIFG DYDT DGTGVRDYIHVVDL
Sbjct  181  PVGAHSSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSIFGQDYDTADGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRLNA GCRAWNIGTG GSSVL+VK+TFEQVNGV IAFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLNAQGCRAWNIGTGQGSSVLEVKNTFEQVNGVPIAFEFAPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            FADNQRA++ELGW P+YTLEDMLKDSWNWQKQNPQGY
Sbjct  301  FADNQRAMNELGWAPKYTLEDMLKDSWNWQKQNPQGY  337


> A0A1P8ELC6 UDP-glucose 4-epimerase [Acinetobacter soli]
Length=337

 Score =  608 bits (1569),  Expect = 0.0
 Identities = 298/337 (88%), Positives = 315/337 (93%), Gaps = 0/337 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELL A+H VVV+DNLSNSS EAL RV+ L GKSL+FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLQAHHDVVVLDNLSNSSREALVRVEALAGKSLEFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RDS +LDQVF Q+ IDAVIHFAGLKAVGESQQIPL YFDNNIAGSI LV AM RAGVFKL
Sbjct  61   RDSQILDQVFKQFQIDAVIHFAGLKAVGESQQIPLTYFDNNIAGSIHLVDAMARAGVFKL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEAN+SPLNEDMPTGMPSNNYGYTKLIVEQML+KLA+AD RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANSSPLNEDMPTGMPSNNYGYTKLIVEQMLQKLALADARWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH SG+IGEDPQGIPNNLMPYVTQVAVGRR+KLSIFG DYDT DGTGVRDYIHVVDL
Sbjct  181  PVGAHPSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSIFGQDYDTADGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRLNA GCRAWNIGTG GSSVL+VK+TFEQVNGV IAFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLNAQGCRAWNIGTGQGSSVLEVKNTFEQVNGVPIAFEFAPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            FADNQRA++ELGW P+YTLEDMLKDSWNWQKQNPQGY
Sbjct  301  FADNQRAMNELGWAPKYTLEDMLKDSWNWQKQNPQGY  337


> N9BZR5 UDP-glucose 4-epimerase [Acinetobacter soli NIPH 2899]
Length=337

 Score =  606 bits (1563),  Expect = 0.0
 Identities = 297/337 (88%), Positives = 314/337 (93%), Gaps = 0/337 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELL A+H VVV+DNLSNSS EAL RV+ L GKSL+FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLQAHHDVVVLDNLSNSSREALVRVEALAGKSLEFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RDS +LDQVF Q+ IDAVIHFAGLKAVGESQQIPL YFDNNIAGSI LV AM RAGVFKL
Sbjct  61   RDSQMLDQVFKQFQIDAVIHFAGLKAVGESQQIPLTYFDNNIAGSIHLVDAMARAGVFKL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEAN+SPLNEDMPTGMPSNNYGYTKLIVEQML+KLA+AD RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANSSPLNEDMPTGMPSNNYGYTKLIVEQMLQKLALADARWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH SG+IGEDPQGIPNNLMPYVTQVAVGRR+KLSIFG DYDT DGTGVRDYIHVVDL
Sbjct  181  PVGAHSSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSIFGQDYDTADGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRLNA GCRAWNIGTG GSSVL+VK+TFEQVNGV IAFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLNAQGCRAWNIGTGQGSSVLEVKNTFEQVNGVPIAFEFAPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            FADNQRA++EL W P+YTLEDMLKDSWNWQKQNPQGY
Sbjct  301  FADNQRAMNELDWAPKYTLEDMLKDSWNWQKQNPQGY  337


> A0A2S2FHA0 UDP-glucose 4-epimerase [Acinetobacter defluvii]
Length=339

 Score =  603 bits (1556),  Expect = 0.0
 Identities = 297/337 (88%), Positives = 313/337 (93%), Gaps = 0/337 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MA ILVTGGAGYIGSHTCVELLNA HSVVV DNLSNSSEEAL RVQ LT KSL FV+GDI
Sbjct  1    MANILVTGGAGYIGSHTCVELLNAGHSVVVFDNLSNSSEEALVRVQALTAKSLIFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD+  LDQVFA + IDAVIHFAGLKAVGESQQIPL YFDNNIAGSISLV+AM+RA VF L
Sbjct  61   RDANALDQVFAAHQIDAVIHFAGLKAVGESQQIPLVYFDNNIAGSISLVQAMQRANVFNL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEAN SPLNEDMPTGMPSNNYGYTKLIVEQML+KLAIAD RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANISPLNEDMPTGMPSNNYGYTKLIVEQMLQKLAIADARWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SG+IGEDPQGIPNNLMPYVTQVAVGRR+KLSIFG DYDT+DGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSIFGQDYDTVDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL A GCRAWNIGTGNGSSVL+VK+TFEQVNGVA+AFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLEAAGCRAWNIGTGNGSSVLEVKNTFEQVNGVAVAFEFAPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            FADN RA+ ELGW P+YTLEDML DSWNWQKQNP+GY
Sbjct  301  FADNARAIAELGWKPQYTLEDMLADSWNWQKQNPEGY  337


> R9B8J3 UDP-glucose 4-epimerase [Acinetobacter tandoii DSM 14970 
= CIP 107469]
Length=338

 Score =  603 bits (1554),  Expect = 0.0
 Identities = 293/338 (87%), Positives = 316/338 (93%), Gaps = 0/338 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELL A H VVV+DNLSNSS E+L RVQQL+GKSLDFV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLTAGHDVVVLDNLSNSSVESLMRVQQLSGKSLDFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD   LDQ+FAQY+IDAVIHFAGLKAVGESQQIPL YFDNNI GS++LVKAMERAGVFKL
Sbjct  61   RDGETLDQLFAQYTIDAVIHFAGLKAVGESQQIPLTYFDNNITGSLNLVKAMERAGVFKL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEANTSPLNE+MPTGMPSNNYGYTKLIVEQML+KL++AD RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANTSPLNEEMPTGMPSNNYGYTKLIVEQMLQKLSVADKRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SG+IGEDPQGIPNNLMPYVTQVAVGRR+KL+IFG DYDTIDGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLAIFGQDYDTIDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL A GCRAWNIGTG G+SVLQ+K+TFEQVNG+AIAFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLAATGCRAWNIGTGQGASVLQIKNTFEQVNGIAIAFEFAPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYS  338
            FADN RA+ EL W P+Y LEDML DSWNWQKQNPQGY+
Sbjct  301  FADNTRAVTELNWQPQYGLEDMLADSWNWQKQNPQGYA  338


> A0A2L0HTZ2 UDP-glucose 4-epimerase [Acinetobacter sp. ACNIH2]
Length=338

 Score =  603 bits (1554),  Expect = 0.0
 Identities = 293/338 (87%), Positives = 316/338 (93%), Gaps = 0/338 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELL A H VVV+DNLSNSS E+L RVQQL+GKSLDFV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLTAGHDVVVLDNLSNSSVESLMRVQQLSGKSLDFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD   LDQ+FAQY+IDAVIHFAGLKAVGESQQIPL YFDNNI GS++LVKAMERAGVFKL
Sbjct  61   RDGETLDQLFAQYTIDAVIHFAGLKAVGESQQIPLTYFDNNITGSLNLVKAMERAGVFKL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEANTSPLNE+MPTGMPSNNYGYTKLIVEQML+KL++AD RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANTSPLNEEMPTGMPSNNYGYTKLIVEQMLQKLSVADKRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SG+IGEDPQGIPNNLMPYVTQVAVGRR+KL+IFG DYDTIDGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLAIFGQDYDTIDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL A GCRAWNIGTG G+SVLQ+K+TFEQVNG+AIAFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLAATGCRAWNIGTGQGASVLQIKNTFEQVNGIAIAFEFAPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYS  338
            FADN RA+ EL W P+Y LEDML DSWNWQKQNPQGY+
Sbjct  301  FADNTRAVTELNWQPQYGLEDMLADSWNWQKQNPQGYA  338


> A0A178FZ19 UDP-glucose 4-epimerase [Acinetobacter sp. SFC]
Length=338

 Score =  599 bits (1545),  Expect = 0.0
 Identities = 295/337 (88%), Positives = 314/337 (93%), Gaps = 0/337 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELLN+ H VVV+DNL NSSEE+L RVQ LTGK+L FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLNSGHEVVVLDNLCNSSEESLNRVQVLTGKTLAFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD+ +LDQVF Q+SIDAVIHFAGLKAVGESQQIPL YFDNNIAGSISLVKAMERAGVF L
Sbjct  61   RDAQVLDQVFQQHSIDAVIHFAGLKAVGESQQIPLTYFDNNIAGSISLVKAMERAGVFNL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQ+LEKLAI+D RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQLLEKLAISDKRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SGQIGEDPQGIPNNLMP+VTQVAVGRR+KLSIFG DYDTIDGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGQIGEDPQGIPNNLMPFVTQVAVGRREKLSIFGQDYDTIDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL A GCRAWNIGTGNGSSVLQVK+TFE+VNGV + FEF+PRR GDVATS
Sbjct  241  ANAHLCALNNRLGAQGCRAWNIGTGNGSSVLQVKNTFEKVNGVPVKFEFSPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            FADN RA+ ELGW P+Y LEDML DSWNWQKQNP GY
Sbjct  301  FADNARAVTELGWHPQYGLEDMLADSWNWQKQNPNGY  337


> A0A2C9WU24 UDP-glucose 4-epimerase [Acinetobacter sp. ANC 4655]
Length=338

 Score =  599 bits (1545),  Expect = 0.0
 Identities = 295/337 (88%), Positives = 314/337 (93%), Gaps = 0/337 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELLN+ H VVV+DNL NSSEE+L RVQ LTGK+L FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLNSGHEVVVLDNLCNSSEESLNRVQVLTGKTLAFVEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD+ +LDQVF Q+SIDAVIHFAGLKAVGESQQIPL YFDNNIAGSISLVKAMERAGVF L
Sbjct  61   RDAQVLDQVFQQHSIDAVIHFAGLKAVGESQQIPLTYFDNNIAGSISLVKAMERAGVFNL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQ+LEKLAI+D RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQLLEKLAISDKRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SGQIGEDPQGIPNNLMP+VTQVAVGRR+KLSIFG DYDTIDGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGQIGEDPQGIPNNLMPFVTQVAVGRREKLSIFGQDYDTIDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL A GCRAWNIGTGNGSSVLQVK+TFE+VNGV + FEF+PRR GDVATS
Sbjct  241  ANAHLCALNNRLGAQGCRAWNIGTGNGSSVLQVKNTFEKVNGVPVKFEFSPRREGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            FADN RA+ ELGW P+Y LEDML DSWNWQKQNP GY
Sbjct  301  FADNARAVTELGWHPQYGLEDMLADSWNWQKQNPNGY  337


> N9TMV5 UDP-glucose 4-epimerase [Acinetobacter sp. ANC 3880]
Length=338

 Score =  593 bits (1528),  Expect = 0.0
 Identities = 288/338 (85%), Positives = 313/338 (93%), Gaps = 0/338 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTC+ELLNA+H VVV DNLSNSSEEAL RVQ+L  KSL FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCLELLNASHDVVVFDNLSNSSEEALRRVQKLANKSLVFVKGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            R+   LDQVF  YSIDAVIHFAGLKAVGESQQ+PL YFDNNIAGS  LVKAMERAGVF L
Sbjct  61   RNQDALDQVFQDYSIDAVIHFAGLKAVGESQQVPLTYFDNNIAGSAQLVKAMERAGVFNL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEAN+SPLNEDMPTGMP+NNYGYTKLIVEQML+KLA AD+RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANSSPLNEDMPTGMPNNNYGYTKLIVEQMLQKLAQADSRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SGQIGEDPQGIPNNLMPYVTQVAVGRR+KL+I+G+DYDT+DGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGQIGEDPQGIPNNLMPYVTQVAVGRREKLAIYGNDYDTVDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL+A GCRAWNIGTGNGSSVL+VK+TFEQ+N V +AFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLSAQGCRAWNIGTGNGSSVLEVKNTFEQINAVPVAFEFAPRRAGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYS  338
            FADN RA+ ELGW P+YTLEDML DSWNWQKQNP G++
Sbjct  301  FADNSRAITELGWQPQYTLEDMLADSWNWQKQNPNGFN  338


> N9TDG6 UDP-glucose 4-epimerase [Acinetobacter sp. CIP 70.18]
Length=338

 Score =  592 bits (1527),  Expect = 0.0
 Identities = 288/338 (85%), Positives = 313/338 (93%), Gaps = 0/338 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTC+ELLNA+H VVV DNLSNSSEEAL RVQ+L  KSL FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCLELLNASHDVVVFDNLSNSSEEALRRVQKLANKSLVFVKGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            R+   LDQVF  YSIDAVIHFAGLKAVGESQQ+PL YFDNNIAGS  LVKAMERAGVF L
Sbjct  61   RNQDALDQVFQAYSIDAVIHFAGLKAVGESQQVPLTYFDNNIAGSAQLVKAMERAGVFNL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEAN+SPLNEDMPTGMP+NNYGYTKLIVEQML+KLA AD+RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANSSPLNEDMPTGMPNNNYGYTKLIVEQMLQKLAQADSRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SGQIGEDPQGIPNNLMPYVTQVAVGRR+KL+I+G+DYDT+DGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGQIGEDPQGIPNNLMPYVTQVAVGRREKLAIYGNDYDTVDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL+A GCRAWNIGTGNGSSVL+VK+TFEQ+N V +AFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLSAQGCRAWNIGTGNGSSVLEVKNTFEQINAVPVAFEFAPRRAGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYS  338
            FADN RA+ ELGW P+YTLEDML DSWNWQKQNP G++
Sbjct  301  FADNSRAITELGWQPQYTLEDMLADSWNWQKQNPNGFN  338


> N8XNC0 UDP-glucose 4-epimerase [Acinetobacter sp. CIP 56.2]
Length=338

 Score =  592 bits (1527),  Expect = 0.0
 Identities = 288/338 (85%), Positives = 313/338 (93%), Gaps = 0/338 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTC+ELLNA+H VVV DNLSNSSEEAL RVQ+L  KSL FV+GDI
Sbjct  1    MAKILVTGGAGYIGSHTCLELLNASHEVVVFDNLSNSSEEALRRVQKLANKSLVFVKGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            R+   LDQVF  YSIDAVIHFAGLKAVGESQQ+PL YFDNNIAGS  LVKAMERAGVF L
Sbjct  61   RNQDALDQVFQAYSIDAVIHFAGLKAVGESQQVPLTYFDNNIAGSAQLVKAMERAGVFNL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEAN+SPLNEDMPTGMP+NNYGYTKLIVEQML+KLA AD+RWSIALLRYFN
Sbjct  121  VFSSSATVYDEANSSPLNEDMPTGMPNNNYGYTKLIVEQMLQKLAQADSRWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SGQIGEDPQGIPNNLMPYVTQVAVGRR+KL+I+G+DYDT+DGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGQIGEDPQGIPNNLMPYVTQVAVGRREKLAIYGNDYDTVDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL+A GCRAWNIGTGNGSSVL+VK+TFEQ+N V +AFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLSAQGCRAWNIGTGNGSSVLEVKNTFEQINAVPVAFEFAPRRAGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYS  338
            FADN RA+ ELGW P+YTLEDML DSWNWQKQNP G++
Sbjct  301  FADNSRAITELGWQPQYTLEDMLADSWNWQKQNPNGFN  338


> A0A2H9YPZ2 UDP-glucose 4-epimerase [Acinetobacter pseudolwoffii]
Length=338

 Score =  590 bits (1520),  Expect = 0.0
 Identities = 291/337 (86%), Positives = 310/337 (92%), Gaps = 0/337 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELLNA H VVV+DNL NS+ E+L RVQQLT KSL F+QGDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLNAGHEVVVLDNLCNSAAESLNRVQQLTQKSLTFIQGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD+ LLDQVF Q+SIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLV+AM+RA VFKL
Sbjct  61   RDAQLLDQVFQQHSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVQAMQRAQVFKL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVY E N SPLNE+MPTGMP+NNYGYTKLIVEQ+LEKL++AD RWSIALLRYFN
Sbjct  121  VFSSSATVYGENNPSPLNEEMPTGMPTNNYGYTKLIVEQLLEKLSVADERWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SGQIGEDPQGIPNNLMP+VTQVAVGRR+KLSIFG DYDT+DGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGQIGEDPQGIPNNLMPFVTQVAVGRREKLSIFGHDYDTVDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL A GCRAWNIGTGNG SVLQVKDTFEQVNGVAIAFE APRR GDVAT 
Sbjct  241  ANAHLCALNNRLTAQGCRAWNIGTGNGISVLQVKDTFEQVNGVAIAFELAPRREGDVATC  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            FADN RA+ ELGW P+Y LEDML DSWNWQKQNP GY
Sbjct  301  FADNTRAVQELGWQPQYGLEDMLADSWNWQKQNPNGY  337


> A0A0F7YYT2 UDP-glucose 4-epimerase [Acinetobacter baumannii AB5075]
Length=338

 Score =  583 bits (1502),  Expect = 0.0
 Identities = 282/338 (83%), Positives = 314/338 (93%), Gaps = 0/338 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            MAKILVTGGAGYIGSHTCVELL A H V V DNLSNSS+E+L RVQ++T KSL F++GDI
Sbjct  1    MAKILVTGGAGYIGSHTCVELLEAGHEVFVFDNLSNSSKESLNRVQEITQKSLTFIEGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            R+S  LD+VF +++IDAVIHFAGLKAVGESQ+ PL YFDNNIAGSI LVK+ME+AGV+ L
Sbjct  61   RNSDELDRVFQEHTIDAVIHFAGLKAVGESQEKPLIYFDNNIAGSIQLVKSMEKAGVYTL  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVYDEANTSPLNE+MPTGMPSNNYGYTKLIVEQ+L+KL++AD++WSIALLRYFN
Sbjct  121  VFSSSATVYDEANTSPLNEEMPTGMPSNNYGYTKLIVEQLLQKLSVADSKWSIALLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            PVGAH+SG+IGEDPQGIPNNLMPYVTQVAVGRR+KLSI+G+DYDTIDGTGVRDYIHVVDL
Sbjct  181  PVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSIYGNDYDTIDGTGVRDYIHVVDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            ANAHLCALNNRL A GCRAWNIGTGNGSSVLQVK+TFEQVNGV +AFEFAPRR GDVATS
Sbjct  241  ANAHLCALNNRLQAQGCRAWNIGTGNGSSVLQVKNTFEQVNGVPVAFEFAPRRAGDVATS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYS  338
            FADN RA+ ELGW P+Y LEDMLKDSWNWQKQNP GY+
Sbjct  301  FADNARAVAELGWKPQYGLEDMLKDSWNWQKQNPNGYN  338


> Q2QD27 UDP-glucose 4-epimerase [Aeromonas hydrophila]
Length=341

 Score =  400 bits (1027),  Expect = 2e-141
 Identities = 199/334 (60%), Positives = 248/334 (74%), Gaps = 1/334 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            ILVTGGAGYIGSHT VELL A   VVV+DNLSNSS E+L RV+++TGK + FV+GD+ D 
Sbjct  3    ILVTGGAGYIGSHTLVELLGAGQQVVVLDNLSNSSPESLKRVERITGKPVTFVEGDVLDR  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
              L Q+FA + I++VIHFAGLKAVGES QIPL Y+ NNI G++ L + M +AGVF+LVFS
Sbjct  63   ACLQQLFAAHKIESVIHFAGLKAVGESSQIPLTYYQNNITGTLVLCEEMAKAGVFRLVFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY +  + PL ED PT   +N YG +KL+VE++L  L+ +D RW+I LLRYFNPVG
Sbjct  123  SSATVYGDPASVPLREDFPTSA-TNPYGRSKLMVEEILRDLSKSDPRWAIVLLRYFNPVG  181

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH+SG IGEDP GIPNNL+PY++QV VG+ ++L +FG+DY T DGTGVRDYIHVVDLA  
Sbjct  182  AHESGLIGEDPNGIPNNLLPYISQVGVGKLKELGVFGNDYPTPDGTGVRDYIHVVDLALG  241

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            HL AL       G   +N+GTG G SVLQ+   FE V+G  IA++  PRR GD+A  +A+
Sbjct  242  HLKALARIAADTGVFTYNLGTGQGYSVLQMISAFEAVSGRTIAYQIKPRRPGDIAECWAE  301

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
              +A DELGW     LE M+ D+W WQ QNP GY
Sbjct  302  PHKARDELGWQAERGLEQMMVDTWRWQSQNPNGY  335


> A1Y9L8 UDP-glucose 4-epimerase [Aeromonas hydrophila]
Length=337

 Score =  380 bits (976),  Expect = 9e-134
 Identities = 188/335 (56%), Positives = 238/335 (71%), Gaps = 1/335 (0%)

Query  3    KILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRD  62
            K+LVTGG GYIGSHTC+ L  A    VVVDNL NS    L R+  ++G+   F QGDIRD
Sbjct  2    KVLVTGGCGYIGSHTCLALQAAGMEPVVVDNLCNSKAGVLARIAAISGREPLFYQGDIRD  61

Query  63   STLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVF  122
              LLD++F +  I AVIHFA LKAVGES ++PL Y++NN+ G+++L++AM+RAGV  LVF
Sbjct  62   PALLDRIFGEQQIAAVIHFAALKAVGESTRLPLEYYENNLGGTLTLLQAMKRAGVNSLVF  121

Query  123  SSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPV  182
            SSSATVY +  ++P+ ED P    +N YG +KLI+E++LE L  A+  WS+ LLRYFNPV
Sbjct  122  SSSATVYGDPASTPIREDFPRSA-TNPYGRSKLIIEEILEDLQRAEPHWSMTLLRYFNPV  180

Query  183  GAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLAN  242
            GAH+SG +GEDPQGIPNNLMP++TQVA+GRR  LS+FG+DY TIDGTGVRDYIHV+DLA 
Sbjct  181  GAHESGTLGEDPQGIPNNLMPFLTQVAIGRRDTLSVFGNDYPTIDGTGVRDYIHVMDLAE  240

Query  243  AHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFA  302
             H+ AL +     G   +N+GTG G SVLQ+   FE  +G  + +   PRR GD+A  +A
Sbjct  241  GHVKALQHCARQGGVHVYNLGTGQGQSVLQMVAAFEAASGRQLPYRIEPRRPGDIAECWA  300

Query  303  DNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            D  +A  ELGW     L  M  DSW WQ  NPQGY
Sbjct  301  DPAKAERELGWRASRDLATMCTDSWRWQSANPQGY  335


> O54385 UDP-glucose 4-epimerase [Brucella abortus]
Length=335

 Score =  379 bits (973),  Expect = 2e-133
 Identities = 194/334 (58%), Positives = 238/334 (71%), Gaps = 2/334 (1%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            ILVTGGAGYIGSHTCV+L+ A H VVVVDN  NS  EAL R++++TG++     GDIRD 
Sbjct  3    ILVTGGAGYIGSHTCVQLIEAGHEVVVVDNFDNSHPEALHRIEKITGRAPRREPGDIRDR  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
             L++QV  ++   AVIHFAGLKAVGES + PL Y+D N+ G++ L++AME  GV KLVFS
Sbjct  63   ALMEQVIKRHKCTAVIHFAGLKAVGESSEKPLLYYDCNVLGTLRLLQAMEATGVKKLVFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY + +  P+ ED P    +N YG TKL++E ML  L  +D  W+IA+LRYFNPVG
Sbjct  123  SSATVYGDPDKLPITEDQPLS-ATNPYGRTKLVIEDMLRDLYNSDNSWAIAILRYFNPVG  181

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH+SG IGEDP+GIPNNLMP + QVA GRR+KL+I+G+DY T DGTGVRDYIHV DLA  
Sbjct  182  AHESGLIGEDPKGIPNNLMPIIAQVATGRREKLNIWGNDYPTPDGTGVRDYIHVNDLAAG  241

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            HL AL  +L+   C A N+GTG G SVL V   FE V+   I +E APRR GDVA  +AD
Sbjct  242  HLKAL-KKLDKPKCFAVNLGTGQGYSVLDVIKAFEHVSNREIKYEIAPRRPGDVAECYAD  300

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
               A   LGW     L +M +D WNWQ +NP GY
Sbjct  301  PGFAKKFLGWSAEKNLREMCQDMWNWQSKNPNGY  334


> Q51148 UDP-glucose 4-epimerase [Neisseria meningitidis]
Length=339

 Score =  376 bits (966),  Expect = 3e-132
 Identities = 179/339 (53%), Positives = 238/339 (70%), Gaps = 0/339 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            M KILVTGG G+IGSHT V LL + H VV++DNL NSS   L R++ +TG+ + F QGDI
Sbjct  1    MKKILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQEIPFYQGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD  +L ++FA+  ID+VIHFAGLKAVGES   P+ Y+DNN++GS+ L + M RAGVF +
Sbjct  61   RDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFSI  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVY +    P  EDMP G  ++ YG +K +VE++L  +  AD RWS+ LLRYFN
Sbjct  121  VFSSSATVYGDPGKVPYTEDMPLGDTTSPYGTSKSMVERILTDIQKADPRWSVILLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            P+GAH+SG IGE P GIPNNL+PY+ QVA G+  +L++FGDDY T DGTG+RDYIHV+DL
Sbjct  181  PIGAHESGLIGEQPNGIPNNLLPYICQVAAGKLPQLAVFGDDYPTPDGTGMRDYIHVMDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            A  H+ A+  +    G   +N+G+G   SVL++   FE  +G+ I ++  PRR GD+A S
Sbjct  241  AEGHVAAMQAKGGVAGVHLFNLGSGRAYSVLEIIRAFEAASGLNIPYQIQPRRAGDLACS  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
            FAD      E GW  + +L  M++DSW W  +NP GY +
Sbjct  301  FADPSHTKQETGWETKRSLAQMMEDSWRWVSRNPDGYGD  339


> F8RC15 UDP-glucose 4-epimerase [Providencia alcalifaciens]
Length=341

 Score =  375 bits (964),  Expect = 6e-132
 Identities = 177/336 (53%), Positives = 244/336 (73%), Gaps = 0/336 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            +LVTGG GYIGSHTCV+++      +++DNL N++ E L R++ +TG    F QGD+RD 
Sbjct  6    VLVTGGLGYIGSHTCVQMIQQGIQPIILDNLHNANLEVLNRIETITGTKPTFYQGDVRDK  65

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
            ++LD +FAQ++I +VIHFAGLKAVGES Q P+ Y+D N+ G++ LV++M +AGV  L+FS
Sbjct  66   SILDTIFAQHTISSVIHFAGLKAVGESVQKPIEYYDVNVNGTLVLVQSMRQAGVKSLIFS  125

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY E   +PL E+   G  ++ YG +K +VE++L  L+I+D+ WSI+LLRYFNPVG
Sbjct  126  SSATVYGEPEHTPLTEESSVGNTNSPYGTSKYMVERILTDLSISDSEWSISLLRYFNPVG  185

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH SG +GEDP GIPNNL P++ QVAVGRR++L++FG DY T DGTGVRDYIHV+DLA+ 
Sbjct  186  AHNSGLMGEDPNGIPNNLTPFIAQVAVGRRKELAVFGGDYATKDGTGVRDYIHVMDLADG  245

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            H+ ALN+     G   +N+GTG G+SVL+V   FE+  G  I ++ A RR GD+A  ++ 
Sbjct  246  HIAALNHMNQGSGLYIYNLGTGTGTSVLEVIAAFEKAVGKPIPYKIAERRAGDIAEYWST  305

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
              +A  ELGW  +Y+++DM  D W WQ  NP GY +
Sbjct  306  PAKAERELGWKAKYSIQDMADDVWRWQSMNPNGYQS  341


> M9P0X5 UDP-glucose 4-epimerase [Providencia alcalifaciens]
Length=341

 Score =  375 bits (963),  Expect = 9e-132
 Identities = 178/336 (53%), Positives = 242/336 (72%), Gaps = 0/336 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            +LVTGG GYIGSHTCV+++      +++DNL N++ E L R++ +TG    F QGD+RD 
Sbjct  6    VLVTGGLGYIGSHTCVQMIQQGIQPIILDNLHNANLEVLNRIETITGTKPTFYQGDVRDK  65

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
            ++LD +FAQ+SI +VIHFAGLKAVGES + P+ Y+D N+ G++ LV++M +AGV  L+FS
Sbjct  66   SILDTIFAQHSISSVIHFAGLKAVGESVEKPIEYYDVNVNGTLVLVQSMRQAGVKSLIFS  125

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY E   +PL E+   G  ++ YG +K +VE++L  L+I+D+ WSI+LLRYFNPVG
Sbjct  126  SSATVYGEPEHTPLTEESSVGNTNSPYGTSKYMVERILTDLSISDSEWSISLLRYFNPVG  185

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH SG +GEDP GIPNNL P++ QVAVGRR++L++FG DY T DGTGVRDYIHV+DLA+ 
Sbjct  186  AHNSGLMGEDPNGIPNNLTPFIAQVAVGRRKELAVFGGDYATKDGTGVRDYIHVMDLADG  245

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            H+ ALN      G   +N+GTG G+SVL+V   FE+  G  I ++ A RR GD+A  ++ 
Sbjct  246  HIAALNYMNKDSGLYIYNLGTGTGTSVLEVIAAFEKAVGKPIPYKIAERRAGDIAEYWST  305

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
              +A  ELGW  +Y ++DM  D W WQ  NP GY N
Sbjct  306  PAKAERELGWKAKYNIQDMADDVWRWQSMNPNGYQN  341


> Q9X3S6 UDP-glucose 4-epimerase [Neisseria meningitidis]
Length=339

 Score =  375 bits (962),  Expect = 1e-131
 Identities = 179/339 (53%), Positives = 236/339 (70%), Gaps = 0/339 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            M  ILVTGG G+IGSHT V LL + H VV++DNL NSS   L R++ +TG+ + F QGDI
Sbjct  1    MKNILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQEIPFYQGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD  +L ++FA+  ID+VIHFAGLKAVGES   P+ Y+DNN++GS+ L + M RAGVF +
Sbjct  61   RDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFSI  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVY +    P  EDMP G  ++ YG +K +VE++L  +  AD RWS+ LLRYFN
Sbjct  121  VFSSSATVYGDPGKVPYTEDMPLGDTTSPYGTSKSMVERILTDIQKADPRWSMILLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            P+GAH+SG IGE P GIPNNL+PY+ QVA G+  +L++FGDDY T DGTG+RDYIHV+DL
Sbjct  181  PIGAHESGLIGEQPNGIPNNLLPYICQVAAGKLPQLAVFGDDYPTPDGTGMRDYIHVMDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            A  H+ A+  + N  G    N+G+G  SSVL++   FE  +G+ I FE  PRR GD+A  
Sbjct  241  AEGHVAAMQAKSNVAGTHLLNLGSGRASSVLEIIRAFEAASGLTIPFEIKPRRAGDLACF  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
            +AD      ++GW  +  L  M++DSW W   NP GY +
Sbjct  301  YADPSYTKAQIGWQTQRDLSQMMEDSWRWVSNNPNGYDD  339


> Q5ND78 UDP-glucose 4-epimerase [Yersinia sp. A125 KOH2]
Length=337

 Score =  370 bits (949),  Expect = 1e-129
 Identities = 184/335 (55%), Positives = 242/335 (72%), Gaps = 3/335 (1%)

Query  4    ILVTGGAGYIGSHTCVELLN-ANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRD  62
            ILVTGGAGYIGSHT + LL  A+  VVV+DNLSN+S E+L RV  LTG++  F QGD+ D
Sbjct  3    ILVTGGAGYIGSHTVLTLLEQADDDVVVLDNLSNASAESLLRVSTLTGRNAIFYQGDVLD  62

Query  63   STLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVF  122
               L +VF+ + ID+VIHFAGLK+VGES   P+ Y+ NN+ GSI L++ M  AGV KL+F
Sbjct  63   RGCLKRVFSDHKIDSVIHFAGLKSVGESVVKPIEYYQNNVIGSIVLLEEMVAAGVTKLIF  122

Query  123  SSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPV  182
            SSSATVY +    PL ED  TG  +N YG +K++VEQ+L+  ++A   +SI  LRYFNPV
Sbjct  123  SSSATVYGDPEFIPLTEDARTGGTTNPYGSSKVMVEQILKDFSVAHPDFSITALRYFNPV  182

Query  183  GAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLAN  242
            GAH SG IGEDP GIPNNL+P++TQVA+G+  KL+++G+DY T+DG+GVRDYIHV+DLA 
Sbjct  183  GAHPSGLIGEDPNGIPNNLLPFITQVAIGKLPKLAVYGNDYPTVDGSGVRDYIHVMDLAE  242

Query  243  AHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFA  302
             HLCALN      G + +N+G+G G SVLQ+   FE+++G  + +    RR GD+A  +A
Sbjct  243  GHLCALNKLTK--GFKVYNLGSGTGYSVLQMITEFERISGKKVPYHIVARRSGDIAECWA  300

Query  303  DNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
              + AL EL W  + +L DML D+WNWQ+ NP GY
Sbjct  301  SAELALKELDWKAKRSLTDMLTDAWNWQQSNPNGY  335


> Q937X4 UDP-glucose 4-epimerase [Edwardsiella ictaluri]
Length=338

 Score =  369 bits (947),  Expect = 2e-129
 Identities = 185/336 (55%), Positives = 235/336 (70%), Gaps = 0/336 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            ILVTGGAGYIGSHT + LL+    VVV+DN  N+S +AL RV+Q+  +     +GD+RD 
Sbjct  3    ILVTGGAGYIGSHTVLALLSRGDEVVVLDNFVNASVQALARVEQICDRQPHLYRGDVRDR  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
             LL Q+FAQ+ I  VIHFAGLKAVGES + PL Y+DNN++G++ L++ M RAGV   +FS
Sbjct  63   ALLQQIFAQHVISDVIHFAGLKAVGESVEKPLEYYDNNVSGTLVLLEEMRRAGVQGFIFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY +  + PL E   TG  +N YG +KL+VEQ+L+ ++ A     I  LRYFNPVG
Sbjct  123  SSATVYGDPESVPLTESSRTGGTTNPYGTSKLMVEQILQDVSRARPEMRITALRYFNPVG  182

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH SG IGEDP GIPNNL+PYV QVAVG+   LSIFG DY T DGTGVRDYIHV+DLA  
Sbjct  183  AHPSGLIGEDPNGIPNNLIPYVAQVAVGKLACLSIFGHDYPTQDGTGVRDYIHVMDLATG  242

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            HL AL+ R      + +N+GTG G SVL +   FE+ +GV I + FAPRR GD+A  +++
Sbjct  243  HLAALDRRDEGASYKVYNLGTGVGYSVLDIVAAFERCSGVTIPYRFAPRRAGDIAECWSN  302

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
               A  ELGW  +Y LE M+ D+W WQ+ NP GY +
Sbjct  303  PALAAQELGWCAQYGLEAMMTDTWRWQQNNPNGYQD  338



Lambda      K        H        a         alpha
   0.319    0.135    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1922410


  Database: 2729f81873f0b53d12221a8b2f1f73b6.TrEMBL.fasta
    Posted date:  Sep 28, 2020  3:17 PM
  Number of letters in database: 7,779
  Number of sequences in database:  23



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40