ACIAD0102 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: a31467794c18d41101cdc58ccfaabd51.SwissProt.fasta
           13 sequences; 4,422 total letters



Query= ACIAD0102

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P55180 UDP-glucose 4-epimerase [Bacillus subtilis (strain 168)]      412    1e-146
  P24325 UDP-glucose 4-epimerase [Haemophilus influenzae (strain ...   392    1e-138
  Q9CNY5 UDP-glucose 4-epimerase [Pasteurella multocida (strain P...   387    1e-136
  Q56093 UDP-glucose 4-epimerase [Salmonella typhi]                    380    7e-134
  Q9F7D4 UDP-glucose 4-epimerase [Yersinia pestis]                     379    1e-133
  P22715 UDP-glucose 4-epimerase [Salmonella typhimurium (strain ...   378    4e-133
  Q553X7 UDP-glucose 4-epimerase [Dictyostelium discoideum]            378    5e-133
  P09147 UDP-glucose 4-epimerase [Escherichia coli (strain K12)]       377    6e-133
  Q8R059 UDP-glucose 4-epimerase [Mus musculus]                        377    8e-133
  P56985 UDP-glucose 4-epimerase [Neisseria meningitidis serogrou...   375    7e-132
  P56986 UDP-glucose 4-epimerase [Neisseria meningitidis serogrou...   374    2e-131
  Q59678 UDP-glucose 4-epimerase [Mannheimia haemolytica]              373    3e-131
  Q14376 UDP-glucose 4-epimerase [Homo sapiens]                        370    4e-130


> P55180 UDP-glucose 4-epimerase [Bacillus subtilis (strain 168)]
Length=339

 Score =  412 bits (1059),  Expect = 1e-146
 Identities = 205/336 (61%), Positives = 250/336 (74%), Gaps = 1/336 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            ILVTGGAGYIGSHTCVELLN+ + +VV+DNLSNSS EAL RV+++TGK L F + D+ D 
Sbjct  3    ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
              +D VFA+  I+AVIHFAGLKAVGES  IPL Y+ NN+ G+  L +AME+ GV K+VFS
Sbjct  63   EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY    TSP+ ED P G  +N YG TKL++EQ+L  L  AD  WS+ALLRYFNP G
Sbjct  123  SSATVYGVPETSPITEDFPLGA-TNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFG  181

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH SG+IGEDP GIPNNLMPYV QVAVG+ ++LS+FG+DY T DGTGVRDYIHVVDLA  
Sbjct  182  AHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEG  241

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            H+ AL   LN+ G  A+N+GTG G SVL++   FE+V+G  + + FA RR GD+AT FAD
Sbjct  242  HVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFAD  301

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
              +A  ELGW  +  LE+M  DSW WQ  N  GY +
Sbjct  302  PAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYKS  337


> P24325 UDP-glucose 4-epimerase [Haemophilus influenzae (strain 
ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=338

 Score =  392 bits (1007),  Expect = 1e-138
 Identities = 191/334 (57%), Positives = 245/334 (73%), Gaps = 0/334 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            ILVTGGAGYIGSHT VELLN    VVV+DNL NSS ++L RV+Q+TGK   F +GDI D 
Sbjct  3    ILVTGGAGYIGSHTVVELLNVGKEVVVLDNLCNSSPKSLERVKQITGKEAKFYEGDILDR  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
             LL ++FA+  I++VIHFAGLKAVGES Q P  Y+ NN+AG++ L++ M++AGV+  VFS
Sbjct  63   ALLQKIFAENEINSVIHFAGLKAVGESVQKPTEYYMNNVAGTLVLIQEMKKAGVWNFVFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY +    P+ ED   G  +N YG +K +VEQ+L   A A+ ++S+ +LRYFNPVG
Sbjct  123  SSATVYGDPKIIPITEDCEVGGTTNPYGTSKYMVEQILRDTAKAEPKFSMTILRYFNPVG  182

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH+SG IGEDP GIPNNL+PY++QVA+G+  +LS+FG DYDT DGTGVRDYIHVVDLA  
Sbjct  183  AHESGLIGEDPNGIPNNLLPYISQVAIGKLAQLSVFGSDYDTHDGTGVRDYIHVVDLAVG  242

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            HL AL    N  G   +N+GTG+G SVL +   FE+ N + IA++   RR GD+AT ++D
Sbjct  243  HLKALQRHENDAGLHIYNLGTGHGYSVLDMVKAFEKANNITIAYKLVERRSGDIATCYSD  302

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
               A  ELGWV    LE M++D+WNWQK NP+GY
Sbjct  303  PSLAAKELGWVAERGLEKMMQDTWNWQKNNPKGY  336


> Q9CNY5 UDP-glucose 4-epimerase [Pasteurella multocida (strain 
Pm70)]
Length=338

 Score =  387 bits (993),  Expect = 1e-136
 Identities = 190/334 (57%), Positives = 244/334 (73%), Gaps = 0/334 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            ILVTGGAGYIGSHT VELLNAN  VVV+DNL NSS ++L RV Q+TGK + F QGDI D+
Sbjct  3    ILVTGGAGYIGSHTVVELLNANKDVVVLDNLCNSSPKSLERVAQITGKQVKFYQGDILDT  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
             LL ++FA+  I +VIHFAGLKAVGES Q P  Y+ NN+ GS+ L++ M++AGV+  VFS
Sbjct  63   ALLQKIFAENQIQSVIHFAGLKAVGESVQKPAEYYMNNVTGSLVLIQEMKKAGVWNFVFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY +    P+ E    G  +N YG +K +VEQ+L+ +A A   +SI +LRYFNPVG
Sbjct  123  SSATVYGDPEIIPITESCKVGGTTNPYGTSKFMVEQILKDIAKATPEFSITILRYFNPVG  182

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH+SG IGEDP GIPNNL+PY++QVA+G+  +LS+FG DY+T DGTGVRDYIHVVDLA  
Sbjct  183  AHESGLIGEDPNGIPNNLLPYISQVAIGKLPQLSVFGSDYETHDGTGVRDYIHVVDLAIG  242

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            HL AL+      G   +N+GTG+G SVL +   FE+VN + I ++   RR GD+AT ++D
Sbjct  243  HLKALDRHEGDAGLHIYNLGTGSGYSVLDMVKAFEKVNDIKIPYKLVDRRPGDIATCYSD  302

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
               A  EL W     LE M+KD+W+WQK+NP+GY
Sbjct  303  PSLAKTELNWTAARGLEQMMKDTWHWQKKNPKGY  336


> Q56093 UDP-glucose 4-epimerase [Salmonella typhi]
Length=338

 Score =  380 bits (975),  Expect = 7e-134
 Identities = 186/337 (55%), Positives = 239/337 (71%), Gaps = 0/337 (0%)

Query  3    KILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRD  62
            ++LVTGG+GYIGSHTCV+LL   H VV++DNL NS    L  +++L GK   FV+GDIR+
Sbjct  2    RVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRN  61

Query  63   STLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVF  122
              L+ ++   ++ID VIHFAGLKAVGES   PL Y+DNN+ G++ LV AM  A V  L+F
Sbjct  62   EALITEILHDHAIDTVIHFAGLKAVGESVAKPLEYYDNNVNGTLRLVSAMRAANVKNLIF  121

Query  123  SSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPV  182
            SSSATVY +    P  E  PTG P + YG +KL+VEQ+L  L  A   WSIALLRYFNPV
Sbjct  122  SSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPEWSIALLRYFNPV  181

Query  183  GAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLAN  242
            GAH SG +GEDPQGIPNNLMPY+ QVAVGRR+ L++FG+DY T DGTGVRDYIHV+DLA+
Sbjct  182  GAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRESLAVFGNDYPTEDGTGVRDYIHVMDLAD  241

Query  243  AHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFA  302
             H+ A+    +  G   +N+G G GSSVL V + F +  G  I + FAPRR GD+   +A
Sbjct  242  GHVVAMEKLADKSGVHIYNLGAGVGSSVLDVVNAFSKACGKPINYHFAPRRDGDLPAYWA  301

Query  303  DNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
            D  +A  EL W    TL++M +D+W+WQ ++PQGYS+
Sbjct  302  DASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYSD  338


> Q9F7D4 UDP-glucose 4-epimerase [Yersinia pestis]
Length=338

 Score =  379 bits (973),  Expect = 1e-133
 Identities = 183/334 (55%), Positives = 240/334 (72%), Gaps = 0/334 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            +LVTGG+GYIGSHTCV+L+ A +  V++DNL NS    L R+  LTG + +   GDIRD 
Sbjct  3    VLVTGGSGYIGSHTCVQLIEAGYKPVILDNLCNSKSSVLARIHSLTGYTPELYAGDIRDR  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
            TLLD +FA + I AVIHFAGLKAVGES   PL Y++NN+ G++ L++AM  A V  L+FS
Sbjct  63   TLLDSIFAAHPIHAVIHFAGLKAVGESVNRPLEYYNNNVFGTLVLLEAMRAAQVKNLIFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY +    P  E  PTG PS+ YG +KL+VEQ+L+ + +AD +W++ +LRYFNPVG
Sbjct  123  SSATVYGDQPQIPYVESFPTGSPSSPYGRSKLMVEQILQDVQLADPQWNMTILRYFNPVG  182

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH SG +GEDPQGIPNNLMP++ QVAVGRR+ L+IFG+ Y T DGTGVRDYIHVVDLA+ 
Sbjct  183  AHPSGLMGEDPQGIPNNLMPFIAQVAVGRRESLAIFGNGYPTPDGTGVRDYIHVVDLADG  242

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            H+ A+       G   +N+G G G SVLQV   F +  G  +A+ FAPRR GD+   +AD
Sbjct  243  HVAAMKTLHGKPGVHIFNLGAGVGHSVLQVVAAFSKACGKPLAYHFAPRREGDLPAYWAD  302

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
              +A ++LGW    +L++M  D+W+WQ +NPQGY
Sbjct  303  ATKAAEQLGWRVSRSLDEMAADTWHWQSKNPQGY  336


> P22715 UDP-glucose 4-epimerase [Salmonella typhimurium (strain 
LT2 / SGSC1412 / ATCC 700720)]
Length=338

 Score =  378 bits (970),  Expect = 4e-133
 Identities = 185/335 (55%), Positives = 237/335 (71%), Gaps = 0/335 (0%)

Query  3    KILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRD  62
            ++LVTGG+GYIGSHTCV+LL   H VV++DNL NS    L  +++L GK   FV+GDIR+
Sbjct  2    RVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRN  61

Query  63   STLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVF  122
              L+ ++   ++ID VIHFAGLKAVGES   PL Y+DNN+ G++ LV AM  A V  L+F
Sbjct  62   EALITEILHDHAIDTVIHFAGLKAVGESVARPLEYYDNNVNGTLRLVSAMRAANVKNLIF  121

Query  123  SSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPV  182
            SSSATVY +    P  E  PTG P + YG +KL+VEQ+L  L  A   WSIALLRYFNPV
Sbjct  122  SSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPEWSIALLRYFNPV  181

Query  183  GAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLAN  242
            GAH SG +GEDPQGIPNNLMPY+ QVAVGRR+ L++FG+DY T DGTGVRDYIHV+DLA+
Sbjct  182  GAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRESLAVFGNDYPTEDGTGVRDYIHVMDLAD  241

Query  243  AHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFA  302
             H+ A+    +  G   +N+G G GSSVL V + F +  G  I + FAPRR GD+   +A
Sbjct  242  GHVVAMEKLADKSGVHIYNLGAGVGSSVLDVVNAFSKACGKPINYHFAPRRDGDLPAYWA  301

Query  303  DNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            D  +A  EL W    TL++M +D+W+WQ ++PQGY
Sbjct  302  DASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGY  336


> Q553X7 UDP-glucose 4-epimerase [Dictyostelium discoideum]
Length=344

 Score =  378 bits (970),  Expect = 5e-133
 Identities = 187/338 (55%), Positives = 247/338 (73%), Gaps = 2/338 (1%)

Query  3    KILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRD  62
            +I+VTGGAGYIGSHT +EL+ A ++ V+VDNLSNSS EA+ RV+ +TGK ++F   DI +
Sbjct  7    RIMVTGGAGYIGSHTVIELIEAGYTPVIVDNLSNSSLEAIKRVESITGKEIEFHHVDIMN  66

Query  63   STLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVF  122
               LD++F   +I +VIHFAGLKAVGES ++PL Y++NNIAG+++L+  M++  V KLVF
Sbjct  67   EKALDEIFETGNIRSVIHFAGLKAVGESNKLPLKYYNNNIAGTLTLLNLMDKHRVKKLVF  126

Query  123  SSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPV  182
            SSSATVY + +T P+ ED P    +N YG TKL VE +L+ L  +D  W+  +LRYFNPV
Sbjct  127  SSSATVYGDPHTVPITEDFPLS-ATNPYGRTKLYVEGILQDLCASDPEWNCIMLRYFNPV  185

Query  183  GAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLAN  242
            GAH SG IGEDP+ IPNNLMPYVTQ A+G+R  LSIFG+DY+T DGTGVRD+IHVVDLA 
Sbjct  186  GAHPSGLIGEDPKDIPNNLMPYVTQTAIGKRPILSIFGNDYNTPDGTGVRDFIHVVDLAK  245

Query  243  AHLCALNN-RLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSF  301
             H+ AL++      GC A+N+GTG G SVL++    +Q +   I ++   RR GDVA+SF
Sbjct  246  GHISALSSLHSKKQGCVAYNLGTGRGYSVLEMVGALKQASHKEIPYQIVSRRKGDVASSF  305

Query  302  ADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
            AD  +AL ELGW   +  +DM +D+W WQ  NP GYS+
Sbjct  306  ADPSKALKELGWKATHNQDDMCRDAWKWQSLNPNGYSD  343


> P09147 UDP-glucose 4-epimerase [Escherichia coli (strain K12)]
Length=338

 Score =  377 bits (969),  Expect = 6e-133
 Identities = 183/335 (55%), Positives = 236/335 (70%), Gaps = 0/335 (0%)

Query  3    KILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRD  62
            ++LVTGG+GYIGSHTCV+LL   H V+++DNL NS    L  +++L GK   FV+GDIR+
Sbjct  2    RVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRN  61

Query  63   STLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVF  122
              L+ ++   ++ID VIHFAGLKAVGES Q PL Y+DNN+ G++ L+ AM  A V   +F
Sbjct  62   EALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIF  121

Query  123  SSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPV  182
            SSSATVY +    P  E  PTG P + YG +KL+VEQ+L  L  A   WSIALLRYFNPV
Sbjct  122  SSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPV  181

Query  183  GAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLAN  242
            GAH SG +GEDPQGIPNNLMPY+ QVAVGRR  L+IFG+DY T DGTGVRDYIHV+DLA+
Sbjct  182  GAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLAD  241

Query  243  AHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFA  302
             H+ A+    N  G   +N+G G G+SVL V + F +  G  + + FAPRR GD+   +A
Sbjct  242  GHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWA  301

Query  303  DNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            D  +A  EL W    TL++M +D+W+WQ ++PQGY
Sbjct  302  DASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGY  336


> Q8R059 UDP-glucose 4-epimerase [Mus musculus]
Length=347

 Score =  377 bits (969),  Expect = 8e-133
 Identities = 191/343 (56%), Positives = 237/343 (69%), Gaps = 6/343 (2%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSN------SSEEALFRVQQLTGKSLD  54
            M K+LVTGGAGYIGSHT +ELL A +S VV+DN  N      S  E+L RVQ+LTG+S++
Sbjct  1    MEKVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGRSVE  60

Query  55   FVQGDIRDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMER  114
            F + DI D   L  +F ++S  AVIHFAGLKAVGES Q PL Y+  N+ G+I L++ M  
Sbjct  61   FEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRA  120

Query  115  AGVFKLVFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIA  174
             GV  LVFSSSATVY      PL+E  PTG  +N YG +K  +E+M+  L  ADT W+  
Sbjct  121  HGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADTAWNAV  180

Query  175  LLRYFNPVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDY  234
            LLRYFNP+GAH SG+IGEDPQGIPNNLMPYV+QVA+GRR+ L++FGDDY T DGTGVRDY
Sbjct  181  LLRYFNPIGAHASGRIGEDPQGIPNNLMPYVSQVAIGRREALNVFGDDYATEDGTGVRDY  240

Query  235  IHVVDLANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRL  294
            IHVVDLA  H+ AL       GCR +N+GTG G SVLQ+    E+ +G  I ++   RR 
Sbjct  241  IHVVDLAKGHIAALKKLKEQCGCRTYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARRE  300

Query  295  GDVATSFADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            GDVA  +A+   A +ELGW     L+ M +D W WQKQNP G+
Sbjct  301  GDVAACYANPSLAHEELGWTAALGLDRMCEDLWRWQKQNPSGF  343


> P56985 UDP-glucose 4-epimerase [Neisseria meningitidis serogroup 
B (strain MC58)]
Length=339

 Score =  375 bits (962),  Expect = 7e-132
 Identities = 179/339 (53%), Positives = 237/339 (70%), Gaps = 0/339 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            M KILVTGG G+IGSHT V LL + H VV++DNL NSS   L R++ +TG+ + F QGDI
Sbjct  1    MKKILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQEIPFYQGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD  +L ++FA+  ID+VIHFAGLKAVGES   P+ Y+DNN++GS+ L + M RAGVF +
Sbjct  61   RDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFSI  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVY +    P  EDMP G  ++ YG +K +VE++L  +  AD RWS+ LLRYFN
Sbjct  121  VFSSSATVYGDPGKVPYTEDMPPGDTTSPYGASKSMVERILTDIQKADPRWSMILLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            P+GAH+SG IGE P GIPNNL+PY+ QVA G+  +L++FGDDY T DGTG+RDYIHV+DL
Sbjct  181  PIGAHESGLIGEQPNGIPNNLLPYICQVAAGKLPQLAVFGDDYPTPDGTGMRDYIHVMDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            A  H+ A+  + N  G    N+G+G  SSVL++   FE  +G+ I +E  PRR GD+A  
Sbjct  241  AEGHVAAMQAKSNVAGTHLLNLGSGRASSVLEIIRAFEAASGLTIPYEVKPRRAGDLACF  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
            +AD      ++GW  +  L  M++DSW W   NP GY +
Sbjct  301  YADPSYTKAQIGWQTQRDLTQMMEDSWRWVSNNPNGYDD  339


> P56986 UDP-glucose 4-epimerase [Neisseria meningitidis serogroup 
C]
Length=339

 Score =  374 bits (959),  Expect = 2e-131
 Identities = 179/339 (53%), Positives = 237/339 (70%), Gaps = 0/339 (0%)

Query  1    MAKILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDI  60
            M KILVTGG G+IGSHT V LL + H VV++DNL NSS   L R++ +TG+ + F QGDI
Sbjct  1    MKKILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQEIPFYQGDI  60

Query  61   RDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKL  120
            RD  +L ++FA+  ID+VIHFAGLKAVGES   P+ Y+DNN++GS+ L + M RAGVFK+
Sbjct  61   RDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFKI  120

Query  121  VFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFN  180
            VFSSSATVY +    P  EDM  G  ++ YG +K +VE++L  +  AD RWS+ LLRYFN
Sbjct  121  VFSSSATVYGDPGKVPYTEDMQPGDTTSPYGTSKSMVERILSDIQKADPRWSVILLRYFN  180

Query  181  PVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDL  240
            P+GAH+SG IGE P GIPNNL+PY+ QVA G+  +L++FG DY T DGTG+RDYIHV+DL
Sbjct  181  PIGAHESGLIGEQPNGIPNNLLPYICQVAAGKLPQLAVFGGDYPTPDGTGMRDYIHVMDL  240

Query  241  ANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATS  300
            A  H+ A+  + N  G    N+G+G  SSVL++   FE  +G+ I +E  PRR GD+A  
Sbjct  241  AEGHVAAMQAKSNVAGTHLLNLGSGRASSVLEIIRAFEAASGLTIPYEVKPRRAGDLACF  300

Query  301  FADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGYSN  339
            +AD   A  ++GW  +  L  M++DSW W   NP GY +
Sbjct  301  YADPSYAKAQIGWQTQRDLTQMMEDSWRWVSNNPNGYDD  339


> Q59678 UDP-glucose 4-epimerase [Mannheimia haemolytica]
Length=338

 Score =  373 bits (958),  Expect = 3e-131
 Identities = 188/334 (56%), Positives = 238/334 (71%), Gaps = 0/334 (0%)

Query  4    ILVTGGAGYIGSHTCVELLNANHSVVVVDNLSNSSEEALFRVQQLTGKSLDFVQGDIRDS  63
            ILVTGGAGYIGSHT VELLN N  +VV+DNLSNSSE +L RV+Q+TGKS+ F QGDI D 
Sbjct  3    ILVTGGAGYIGSHTLVELLNENREIVVLDNLSNSSEVSLERVKQITGKSVKFYQGDILDR  62

Query  64   TLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAGVFKLVFS  123
             +L ++FA+  I++VIHFAGLKAVGE+ +       NN+ GSI LV+ M +A V  +VFS
Sbjct  63   DILRKIFAENQIESVIHFAGLKAVGETSENRYVTIKNNVTGSIVLVEEMLKANVNTIVFS  122

Query  124  SSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALLRYFNPVG  183
            SSATVY +    P+ E  P G  +N YG +K +VE++LE    A  + S  +LRYFN VG
Sbjct  123  SSATVYGDPQIIPIVESCPVGGTTNPYGTSKYMVERILEDTVKAFPQLSAVVLRYFNRVG  182

Query  184  AHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIHVVDLANA  243
            AH+SG IGEDP GIPNNLMP+++QVAVG+  +LS+FG DY+T DGTGVRDYIHVVDLA  
Sbjct  183  AHESGLIGEDPNGIPNNLMPFISQVAVGKLPQLSVFGGDYNTHDGTGVRDYIHVVDLALG  242

Query  244  HLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGDVATSFAD  303
            HL AL+   N  G   +N+GTG G SVL +   FE  NG+ I ++   RR GD+A  ++ 
Sbjct  243  HLKALDKHQNDAGFHVYNLGTGTGYSVLDMVKAFEAANGITIPYKVVDRRPGDIAVCYSA  302

Query  304  NQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
             Q+AL++LGW     LE M+KD+WNWQK NP GY
Sbjct  303  PQKALEQLGWETERGLEQMMKDTWNWQKNNPNGY  336


> Q14376 UDP-glucose 4-epimerase [Homo sapiens]
Length=348

 Score =  370 bits (951),  Expect = 4e-130
 Identities = 189/341 (55%), Positives = 235/341 (69%), Gaps = 6/341 (2%)

Query  3    KILVTGGAGYIGSHTCVELLNANHSVVVVDNLSN------SSEEALFRVQQLTGKSLDFV  56
            K+LVTGGAGYIGSHT +ELL A +  VV+DN  N      S  E+L RVQ+LTG+S++F 
Sbjct  4    KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFE  63

Query  57   QGDIRDSTLLDQVFAQYSIDAVIHFAGLKAVGESQQIPLAYFDNNIAGSISLVKAMERAG  116
            + DI D   L ++F +YS  AVIHFAGLKAVGES Q PL Y+  N+ G+I L++ M+  G
Sbjct  64   EMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHG  123

Query  117  VFKLVFSSSATVYDEANTSPLNEDMPTGMPSNNYGYTKLIVEQMLEKLAIADTRWSIALL  176
            V  LVFSSSATVY      PL+E  PTG  +N YG +K  +E+M+  L  AD  W+  LL
Sbjct  124  VKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLL  183

Query  177  RYFNPVGAHQSGQIGEDPQGIPNNLMPYVTQVAVGRRQKLSIFGDDYDTIDGTGVRDYIH  236
            RYFNP GAH SG IGEDPQGIPNNLMPYV+QVA+GRR+ L++FG+DYDT DGTGVRDYIH
Sbjct  184  RYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIH  243

Query  237  VVDLANAHLCALNNRLNAVGCRAWNIGTGNGSSVLQVKDTFEQVNGVAIAFEFAPRRLGD  296
            VVDLA  H+ AL       GCR +N+GTG G SVLQ+    E+ +G  I ++   RR GD
Sbjct  244  VVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGD  303

Query  297  VATSFADNQRALDELGWVPRYTLEDMLKDSWNWQKQNPQGY  337
            VA  +A+   A +ELGW     L+ M +D W WQKQNP G+
Sbjct  304  VAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGF  344



Lambda      K        H        a         alpha
   0.319    0.135    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1124256


  Database: a31467794c18d41101cdc58ccfaabd51.SwissProt.fasta
    Posted date:  Sep 28, 2020  2:01 PM
  Number of letters in database: 4,422
  Number of sequences in database:  13



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40