ACIAD0028 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 15a2d24a5e7d910ca74375a84b20fead.TrEMBL.fasta
           18 sequences; 3,983 total letters



Query= ACIAD0028

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  N9DK51 Ureidoacrylate amidohydrolase RutB [Acinetobacter ursing...   474    5e-174
  A0A2N6VGP4 Ureidoacrylate amidohydrolase RutB [Acinetobacter ur...   472    4e-173
  N9QXR9 Ureidoacrylate amidohydrolase RutB [Acinetobacter ursing...   468    2e-171
  A0A1P8EL57 Ureidoacrylate amidohydrolase RutB [Acinetobacter soli]   448    1e-163
  A0A0M1I3Y1 Ureidoacrylate amidohydrolase RutB [Acinetobacter sp...   447    2e-163
  N9BZY6 Ureidoacrylate amidohydrolase RutB [Acinetobacter soli N...   447    2e-163
  A0A009ZXG9 Ureidoacrylate amidohydrolase RutB [Acinetobacter sp...   435    6e-159
  A0A2L0HYQ4 Ureidoacrylate amidohydrolase RutB [Acinetobacter sp...   428    1e-155
  Q1M7F4 Putative amidase [Rhizobium leguminosarum bv. viciae (st...  97.4    2e-27 
  Q9RA48 Isochorismatase [Thermus thermophilus]                       76.3    3e-20 
  Q9HKY9 N-carbamoylsarcosine amidase related protein [Thermoplas...  73.9    1e-19 
  E5KBS4 Isochorismatase [Ferroplasma acidiphilum]                    73.6    3e-19 
  D9N4C8 Isochorismatase hydrolase [Candidatus Jettenia caeni]        69.7    4e-18 
  E5KBS3 Nicotamidase-like amidase [Ferroplasma acidiphilum]          69.7    4e-18 
  D3TIB2 Isochorismatase hydrolase [Mangifera indica]                 62.0    2e-15 
  H9NEP9 YaaI [uncultured bacterium]                                  61.2    4e-15 
  A0A0H3LKK8 Putative isochorismatase [Bordetella bronchiseptica ...  51.2    2e-11 
  Q9F5N8 AngB [Vibrio anguillarum]                                    51.6    3e-11 


> N9DK51 Ureidoacrylate amidohydrolase RutB [Acinetobacter ursingii 
ANC 3649]
Length=245

 Score =  474 bits (1220),  Expect = 5e-174
 Identities = 234/245 (96%), Positives = 239/245 (98%), Gaps = 0/245 (0%)

Query  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60
            MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIV+DMQNAYTSIGGYLDLAGFDVSKT
Sbjct  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVIDMQNAYTSIGGYLDLAGFDVSKT  60

Query  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120
            KPVV NIQKA+TAAHAAGIQVIYFKNGWD+QYVEAGGAGSPNFHKSNALKTMRKQPELQG
Sbjct  61   KPVVANIQKAITAAHAAGIQVIYFKNGWDDQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120

Query  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180
            KLLAKGGWDFELIDELQP +QDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
Sbjct  121  KLLAKGGWDFELIDELQPTTQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180

Query  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240
            VESTLRDGFFLEYFGVALDDACYQAGP EMH ASMYNIKTFFGWVSDTQSFV+TFQHN Q
Sbjct  181  VESTLRDGFFLEYFGVALDDACYQAGPPEMHTASMYNIKTFFGWVSDTQSFVDTFQHNPQ  240

Query  241  LAKTA  245
             AKTA
Sbjct  241  FAKTA  245


> A0A2N6VGP4 Ureidoacrylate amidohydrolase RutB [Acinetobacter 
ursingii]
Length=245

 Score =  472 bits (1214),  Expect = 4e-173
 Identities = 233/245 (95%), Positives = 238/245 (97%), Gaps = 0/245 (0%)

Query  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60
            MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIV+DMQNAYTSIGGYLDLAGFDVSKT
Sbjct  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVIDMQNAYTSIGGYLDLAGFDVSKT  60

Query  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120
            KPVV NIQKAV+AAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG
Sbjct  61   KPVVANIQKAVSAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120

Query  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180
            KLLAKGGWDFELIDELQP + DI+IEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
Sbjct  121  KLLAKGGWDFELIDELQPTAHDIMIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180

Query  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240
            VESTLRDGFFLEYFGVALDDACYQAGP EMH ASMYNIKTFFGWVSDTQSFV+TFQHN Q
Sbjct  181  VESTLRDGFFLEYFGVALDDACYQAGPPEMHTASMYNIKTFFGWVSDTQSFVDTFQHNPQ  240

Query  241  LAKTA  245
             AKTA
Sbjct  241  FAKTA  245


> N9QXR9 Ureidoacrylate amidohydrolase RutB [Acinetobacter ursingii 
NIPH 706]
Length=245

 Score =  468 bits (1203),  Expect = 2e-171
 Identities = 230/245 (94%), Positives = 236/245 (96%), Gaps = 0/245 (0%)

Query  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60
            MNTVIADFTERAGTGRVLKAEPEAIQL PEQTALIV+DMQNAY SIGGYLDLAGFDVSKT
Sbjct  1    MNTVIADFTERAGTGRVLKAEPEAIQLVPEQTALIVIDMQNAYNSIGGYLDLAGFDVSKT  60

Query  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120
            KPVV NIQKA+TAAHAAGIQVIYFKNGWD+QYVEAGGAGSPNFHKSNALKTMRKQPELQG
Sbjct  61   KPVVANIQKAITAAHAAGIQVIYFKNGWDDQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120

Query  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180
            KLLAKGGWDFELIDELQP + DIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
Sbjct  121  KLLAKGGWDFELIDELQPTAHDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180

Query  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240
            VESTLRDGFFLEYFGVALDDACYQAGP EMH ASMYNIKTFFGWVSDTQSFV+TFQHN +
Sbjct  181  VESTLRDGFFLEYFGVALDDACYQAGPPEMHTASMYNIKTFFGWVSDTQSFVDTFQHNPE  240

Query  241  LAKTA  245
             AKTA
Sbjct  241  FAKTA  245


> A0A1P8EL57 Ureidoacrylate amidohydrolase RutB [Acinetobacter 
soli]
Length=244

 Score =  448 bits (1152),  Expect = 1e-163
 Identities = 224/245 (91%), Positives = 232/245 (95%), Gaps = 1/245 (0%)

Query  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60
            MNTV+ADFTERAGTG VLKAEPEAIQLAPE TALIV+DMQNAYTSIGGYLDLAGFDVSKT
Sbjct  1    MNTVVADFTERAGTGCVLKAEPEAIQLAPEHTALIVIDMQNAYTSIGGYLDLAGFDVSKT  60

Query  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120
            KPVV+NIQKAV AAHAAGIQVIYFKNGWD  YVEAGGAGSPNFHKSNALKTMRKQPELQG
Sbjct  61   KPVVKNIQKAVAAAHAAGIQVIYFKNGWDKAYVEAGGAGSPNFHKSNALKTMRKQPELQG  120

Query  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180
            KLLAKGGWDFELIDEL P +QDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
Sbjct  121  KLLAKGGWDFELIDELTPLAQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180

Query  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240
            VESTLRDGFFLEYFGVAL+DACYQAGPVEM +ASMYNIKTFFGWVSDTQ+FV TF  +  
Sbjct  181  VESTLRDGFFLEYFGVALEDACYQAGPVEMQQASMYNIKTFFGWVSDTQTFVETFDQS-H  239

Query  241  LAKTA  245
            LAKTA
Sbjct  240  LAKTA  244


> A0A0M1I3Y1 Ureidoacrylate amidohydrolase RutB [Acinetobacter 
sp. C15]
Length=244

 Score =  447 bits (1150),  Expect = 2e-163
 Identities = 223/245 (91%), Positives = 232/245 (95%), Gaps = 1/245 (0%)

Query  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60
            MNTV+ADFTERAGTG VLKAEPEAIQ+APE TALIV+DMQNAYTSIGGYLDLAGFDVSKT
Sbjct  1    MNTVVADFTERAGTGCVLKAEPEAIQMAPEHTALIVIDMQNAYTSIGGYLDLAGFDVSKT  60

Query  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120
            KPVV+NIQKAV AAHAAGIQVIYFKNGWD  YVEAGGAGSPNFHKSNALKTMRKQPELQG
Sbjct  61   KPVVKNIQKAVAAAHAAGIQVIYFKNGWDKAYVEAGGAGSPNFHKSNALKTMRKQPELQG  120

Query  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180
            KLLAKGGWDFELIDEL P +QDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
Sbjct  121  KLLAKGGWDFELIDELTPLAQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180

Query  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240
            VESTLRDGFFLEYFGVAL+DACYQAGPVEM +ASMYNIKTFFGWVSDTQ+FV TF  +  
Sbjct  181  VESTLRDGFFLEYFGVALEDACYQAGPVEMQQASMYNIKTFFGWVSDTQTFVETFDQS-H  239

Query  241  LAKTA  245
            LAKTA
Sbjct  240  LAKTA  244


> N9BZY6 Ureidoacrylate amidohydrolase RutB [Acinetobacter soli 
NIPH 2899]
Length=244

 Score =  447 bits (1150),  Expect = 2e-163
 Identities = 223/245 (91%), Positives = 232/245 (95%), Gaps = 1/245 (0%)

Query  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60
            MNTV+ADFTERAGTG VLKAEPEAIQ+APE TALIV+DMQNAYTSIGGYLDLAGFDVSKT
Sbjct  1    MNTVVADFTERAGTGCVLKAEPEAIQMAPEHTALIVIDMQNAYTSIGGYLDLAGFDVSKT  60

Query  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120
            KPVV+NIQKAV AAHAAGIQVIYFKNGWD  YVEAGGAGSPNFHKSNALKTMRKQPELQG
Sbjct  61   KPVVKNIQKAVAAAHAAGIQVIYFKNGWDKAYVEAGGAGSPNFHKSNALKTMRKQPELQG  120

Query  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180
            KLLAKGGWDFELIDEL P +QDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
Sbjct  121  KLLAKGGWDFELIDELTPLAQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180

Query  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240
            VESTLRDGFFLEYFGVAL+DACYQAGPVEM +ASMYNIKTFFGWVSDTQ+FV TF  +  
Sbjct  181  VESTLRDGFFLEYFGVALEDACYQAGPVEMQQASMYNIKTFFGWVSDTQTFVETFDQS-H  239

Query  241  LAKTA  245
            LAKTA
Sbjct  240  LAKTA  244


> A0A009ZXG9 Ureidoacrylate amidohydrolase RutB [Acinetobacter 
sp. 479375]
Length=229

 Score =  435 bits (1119),  Expect = 6e-159
 Identities = 213/229 (93%), Positives = 220/229 (96%), Gaps = 0/229 (0%)

Query  17   VLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHA  76
            +LKAEPEAIQL PEQTALIV+DMQNAY SIGGYLDLAGFDVSKTKPVV NIQKA+TAAHA
Sbjct  1    MLKAEPEAIQLVPEQTALIVIDMQNAYNSIGGYLDLAGFDVSKTKPVVANIQKAITAAHA  60

Query  77   AGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDEL  136
            AGIQVIYFKNGWD+QYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDEL
Sbjct  61   AGIQVIYFKNGWDDQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDEL  120

Query  137  QPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGV  196
            QP + DIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGV
Sbjct  121  QPTAHDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGV  180

Query  197  ALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQLAKTA  245
            ALDDACYQAGP EMH ASMYNIKTFFGWVSDTQSFV+TFQHN + AKTA
Sbjct  181  ALDDACYQAGPPEMHTASMYNIKTFFGWVSDTQSFVDTFQHNPEFAKTA  229


> A0A2L0HYQ4 Ureidoacrylate amidohydrolase RutB [Acinetobacter 
sp. ACNIH2]
Length=251

 Score =  428 bits (1100),  Expect = 1e-155
 Identities = 212/245 (87%), Positives = 226/245 (92%), Gaps = 1/245 (0%)

Query  2    NTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTK  61
            +TVI+DFTE  G G+ LKAEPE IQ APEQTALIV+DMQNAYTSIGGYLDLAGFDVS T+
Sbjct  7    HTVISDFTEATGQGKTLKAEPENIQFAPEQTALIVIDMQNAYTSIGGYLDLAGFDVSTTQ  66

Query  62   PVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGK  121
            PVV+NI+KAV AAHAA IQVIYFKNGWD+QYVEAGG GSPNFHKSNALKTMRKQPELQGK
Sbjct  67   PVVQNIKKAVAAAHAANIQVIYFKNGWDDQYVEAGGRGSPNFHKSNALKTMRKQPELQGK  126

Query  122  LLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCV  181
            LLAKGGWDFELIDELQP +QD+VIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCV
Sbjct  127  LLAKGGWDFELIDELQPLAQDLVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCV  186

Query  182  ESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHN-QQ  240
            ESTLRDGFFLEYFGVAL DACYQAGP EM  AS+YNIKTFFGWVSDTQSF++TF  N  Q
Sbjct  187  ESTLRDGFFLEYFGVALKDACYQAGPAEMQAASLYNIKTFFGWVSDTQSFIDTFVPNTDQ  246

Query  241  LAKTA  245
            LAK+A
Sbjct  247  LAKSA  251


> Q1M7F4 Putative amidase [Rhizobium leguminosarum bv. viciae (strain 
3841)]
Length=233

 Score = 97.4 bits (241),  Expect = 2e-27
 Identities = 69/219 (32%), Positives = 109/219 (50%), Gaps = 27/219 (12%)

Query  27   LAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKN  86
            L P+ TALI++DMQ  +   GGY+D  G+D+S  +  +E I++ + A  A G  +I+ + 
Sbjct  25   LRPDNTALIIIDMQTDFCGKGGYVDHMGYDLSLVQAPIEPIKRVLAAMRAKGYHIIHTRE  84

Query  87   GWDNQYVEAGGAGSPNFHKSNALKTMRKQ--------PELQGKLLAKG--GWDFELIDEL  136
            G             P+     A K  R Q        P   G++L +G  GWD  +I EL
Sbjct  85   GH-----------RPDLADLPANKRWRSQRIGAGIGDPGPCGRILTRGEPGWD--IIPEL  131

Query  137  QPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGV  196
             P   + +I+KP    F  T L+ +L  + I N++  GI T+VCV +T+R+     Y  +
Sbjct  132  YPIEGETIIDKPGKGSFCATDLELVLNQKRIENIILTGITTDVCVSTTMREANDRGYECL  191

Query  197  ALDDACYQAGPVEMHRASMYNIKT---FFGWVSDTQSFV  232
             L+D C  A     H A++  +K     FG VS++ + V
Sbjct  192  LLEDCC-GATDYGNHLAAIKMVKMQGGVFGSVSNSAALV  229


> Q9RA48 Isochorismatase [Thermus thermophilus]
Length=196

 Score = 76.3 bits (186),  Expect = 3e-20
 Identities = 53/188 (28%), Positives = 88/188 (47%), Gaps = 26/188 (14%)

Query  23   EAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVI  82
            E ++L  ++TALIVVDMQN +    G L +   D  ++ P +  +   +  A  AG +V+
Sbjct  11   ETVELPAKETALIVVDMQNDFAHPKGALFVP--DAPQSVPAIRLL---LERARQAGAKVV  65

Query  83   YFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQPKSQD  142
            Y ++ W  +         P F             ++  +    G W  E+++EL+P+ +D
Sbjct  66   YTQD-WHRE-------DDPEF-------------QIWPRHAVAGTWGAEILEELKPEPED  104

Query  143  IVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVALDDAC  202
            +VI K RY  F+ T LD  L   G++++V  G   N+CV  T        Y  V  +DA 
Sbjct  105  LVIRKVRYDAFYGTPLDHYLHLFGVKHVVVTGTVANICVLHTAGSAALRWYNVVLPEDAT  164

Query  203  YQAGPVEM  210
                P ++
Sbjct  165  SALTPFDL  172


> Q9HKY9 N-carbamoylsarcosine amidase related protein [Thermoplasma 
acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / 
NBRC 15155 / AMRC-C165)]
Length=182

 Score = 73.9 bits (180),  Expect = 1e-19
 Identities = 53/171 (31%), Positives = 83/171 (49%), Gaps = 32/171 (19%)

Query  33   ALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKNGWDNQY  92
            AL+VVDM N +     +  LA  +  KT   V   +K +     +G+ V+Y     D+ Y
Sbjct  4    ALVVVDMVNEFI----HGRLATPEAMKT---VGPARKVIETFRRSGLPVVYVN---DSHY  53

Query  93   VEAGGAGSPNFHKSNALKTMRKQPELQ--GKLLAKGGWDFELIDELQPKSQDIVIEKPRY  150
             +                     PE++  G+   KG    E+IDE++P + D V+EK  Y
Sbjct  54   PD--------------------DPEIRIWGRHSMKGDDGSEVIDEIRPSAGDYVLEKHAY  93

Query  151  SGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVALDDA  201
            SGF+ T LD +LRA GI  +V +G+  ++CV  T  D  +  Y  + ++DA
Sbjct  94   SGFYGTNLDMILRANGIDTVVLIGLDADICVRHTAADALYRNYRIIVVEDA  144


> E5KBS4 Isochorismatase [Ferroplasma acidiphilum]
Length=211

 Score = 73.6 bits (179),  Expect = 3e-19
 Identities = 61/208 (29%), Positives = 92/208 (44%), Gaps = 19/208 (9%)

Query  27   LAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFK-  85
            L P  T L+  D+QN              ++      V N++K    +   G+ V+Y K 
Sbjct  17   LDPAHTMLVNWDIQNGLVK----------NIFNKDEFVSNVKKLTATSREHGVAVLYTKI  66

Query  86   NGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQPKSQDIVI  145
                 +Y+      S  + K   +    K P      +A G  D E+  EL P+  D V+
Sbjct  67   TPLPFKYMAPSNIYS--YMKRFGVDDPSKLPVF----MAPGSEDAEIYRELAPEKDDYVL  120

Query  146  EKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVALDDACYQA  205
             K   S F  T +++ML+  GI  LVF GIAT + VES++RD     Y+ V   D+C  +
Sbjct  121  NKHTASVFTGTNVENMLKGAGITTLVFTGIATEIGVESSVRDAINHGYYTVVASDSC-SS  179

Query  206  GPVEMHRASMYNIKTFFGWVSDTQSFVN  233
               EMH  S+ ++      V DT S +N
Sbjct  180  HSKEMHEISLKSMSA-VTTVMDTGSIIN  206


> D9N4C8 Isochorismatase hydrolase [Candidatus Jettenia caeni]
Length=179

 Score = 69.7 bits (169),  Expect = 4e-18
 Identities = 47/199 (24%), Positives = 92/199 (46%), Gaps = 27/199 (14%)

Query  24   AIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIY  83
            A+    E  A+I+ DM N + +     + A  +V K++ +++ I+  +  A      +IY
Sbjct  3    ALNKPEESYAIIIADMLNDFVN-----EQAPLEVPKSRMIIDPIKGEIKKARKKRTPIIY  57

Query  84   FKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQPKSQDI  143
              +                 HK+N      ++ +L  +   KG    ++I +L+P+ +D 
Sbjct  58   CCDA----------------HKNND-----REFQLWPRHAVKGTKGAQVIQQLEPRKEDY  96

Query  144  VIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVALDDACY  203
            +I K  YS F+ T+LD++L+  GI  ++  G+ TN+CV  T  + +   Y  + +   C 
Sbjct  97   MIAKTSYSCFYKTSLDTLLKKLGITGVIITGVVTNICVLYTAAEAYMRGY-KIVIPQNCV  155

Query  204  QAGPVEMHRASMYNIKTFF  222
             A     H+ ++  +K  F
Sbjct  156  TALTQSEHQFALQQMKRIF  174


> E5KBS3 Nicotamidase-like amidase [Ferroplasma acidiphilum]
Length=179

 Score = 69.7 bits (169),  Expect = 4e-18
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 6/116 (5%)

Query  112  MRKQPELQ--GKLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRN  169
            ++  PE +  G+    G W  E++D L+P   D +++K  Y  FF+T LDS+LRA GI N
Sbjct  54   IKNDPEFKVWGEHAIDGTWGSEIVDALKP-FPDYILKKRHYDAFFDTDLDSLLRASGIAN  112

Query  170  LVFVGIATNVCVESTLRDGFFLEYFGVALDDACYQAGPVEMHRAS-MYNIKTFFGW  224
            +   GI+T++CVE T    F+  Y    + D C  A     H+ S + NIK  +G+
Sbjct  113  IYIFGISTDICVEHTCAAAFYRYYNVKVISDLC--ACIDNSHQISALTNIKINYGY  166


> D3TIB2 Isochorismatase hydrolase [Mangifera indica]
Length=179

 Score = 62.0 bits (149),  Expect = 2e-15
 Identities = 49/202 (24%), Positives = 89/202 (44%), Gaps = 32/202 (16%)

Query  29   PEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKNGW  88
            P+   L+V+DMQN ++++              KP+++N+   +     A I V + ++  
Sbjct  9    PKTCVLLVIDMQNYFSAMA-------------KPILDNLLTTIRLCRRASIPVFFTRH--  53

Query  89   DNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQP-KSQDIVIEK  147
                           HKS A   M  +      L+  G  + EL+ +++   S D VIEK
Sbjct  54   --------------CHKSPADYAMLGE-WWNNDLVYDGTVEAELMPQIKEVASADEVIEK  98

Query  148  PRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVALDDACYQAGP  207
              YS F +T L   L    ++ ++  G+ T +C E+T R+  F+  F V           
Sbjct  99   NTYSAFVSTRLQERLVEMDVKEVIVSGVMTTLCCETTAREA-FVRGFRVFFSTDATATSD  157

Query  208  VEMHRASMYNIKTFFGWVSDTQ  229
            +E+H A++ N+   F ++ D +
Sbjct  158  IELHEATLKNLAYGFAYLVDCE  179


> H9NEP9 YaaI [uncultured bacterium]
Length=185

 Score = 61.2 bits (147),  Expect = 4e-15
 Identities = 45/164 (27%), Positives = 71/164 (43%), Gaps = 27/164 (16%)

Query  30   EQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKNGWD  89
            + TALI++DM N     GG  DL    +  T P+ E +          G+ VIY  + ++
Sbjct  3    QDTALIIIDMINKMDFDGGE-DL----LEHTLPMTERLHSFKKELKEEGLPVIYVNDNFE  57

Query  90   NQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQPKSQDIVIEKPR  149
                           + N    +++          K G    +I+ + P   D  I KP+
Sbjct  58   -------------LWQDNVSDLIKE---------CKKGRGQPVIERILPDEDDYFIIKPK  95

Query  150  YSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEY  193
            +SGFF T L  +L    +RNL+  GIA ++CV  T  D +  +Y
Sbjct  96   HSGFFGTQLSILLEQLEVRNLILTGIAGDICVLFTANDAYMRDY  139


> A0A0H3LKK8 Putative isochorismatase [Bordetella bronchiseptica 
(strain ATCC BAA-588 / NCTC 13252 / RB50)]
Length=205

 Score = 51.2 bits (121),  Expect = 2e-11
 Identities = 45/211 (21%), Positives = 87/211 (41%), Gaps = 31/211 (15%)

Query  34   LIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYV  93
            L++VD  N      G+ D A F        +E  +  + AA   G  V + +      Y 
Sbjct  25   LLIVDFVN------GFADPAQFGGGNIAAAIETTRTVLAAARERGWAVAHSRI----VYA  74

Query  94   EAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQPKSQDIVIEKPRYSGF  153
            +    G+    K   + T+++                 ++ +L P++ + V+ K   S F
Sbjct  75   DDDADGNIFSIKVPGMLTLKEHAPASA-----------IVPQLAPQAGEYVVRKSTPSAF  123

Query  154  FNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVALDDACYQAGPVEMHRA  213
            + T L + L  RG++ L+  G  T+ CV +++ D     +  + L D C     +  H A
Sbjct  124  YGTMLAAWLAQRGVQTLLVAGATTSGCVRASVVDAMSAGFRPLVLSD-CVGDRALGPHEA  182

Query  214  SMYNIKTFFGWVSDTQSFVNTFQHNQQLAKT  244
            ++++++         Q +     H++ LAKT
Sbjct  183  NLFDMR---------QKYAAVMTHDEALAKT  204


> Q9F5N8 AngB [Vibrio anguillarum]
Length=287

 Score = 51.6 bits (122),  Expect = 3e-11
 Identities = 52/206 (25%), Positives = 90/206 (44%), Gaps = 27/206 (13%)

Query  29   PEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKNGW  88
            P+++ ++V D+Q AY     +L+     +S    ++ N+ K   +A +AGI V+Y     
Sbjct  28   PKKSVVLVHDLQ-AY-----FLNFFDKTLSPVPELLRNVNKVTESARSAGIPVVYTAQPA  81

Query  89   DNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQPKSQDIVIEKP  148
            +           PN     AL T     +  G  L +   D E++ E+ P+ +DI   K 
Sbjct  82   NQD---------PN---ERALLT-----DFWGVGLTQ---DTEIVPEVSPQPEDIQYTKW  121

Query  149  RYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVALDDACYQAGPV  208
            RYS F  T L   ++      LV VG+  ++ + ST  D F L+     + DA       
Sbjct  122  RYSAFKKTPLLEWMKEEQRDQLVIVGVYGHIGILSTALDAFMLDIKPFVIGDAIADFSK-  180

Query  209  EMHRASMYNIKTFFGWVSDTQSFVNT  234
            E H  ++  + +  G V     F+++
Sbjct  181  EDHMNTLKYVASRSGSVKSVDEFIDS  206



Lambda      K        H        a         alpha
   0.322    0.136    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658308


  Database: 15a2d24a5e7d910ca74375a84b20fead.TrEMBL.fasta
    Posted date:  Sep 19, 2020  12:15 PM
  Number of letters in database: 3,983
  Number of sequences in database:  18



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40