ACIAD0028 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: cac041b3d81caeb0ec8744359dc8fa87.SwissProt.fasta
           23 sequences; 5,387 total letters



Query= ACIAD0028

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FFZ6 Ureidoacrylate amidohydrolase RutB [Acinetobacter baylyi...   493    0.0   
  A8GCT5 Ureidoacrylate amidohydrolase RutB [Serratia proteamacul...   336    2e-119
  B7MTF4 Ureidoacrylate amidohydrolase RutB [Escherichia coli O81...   335    2e-119
  A6T7A1 Ureidoacrylate amidohydrolase RutB [Klebsiella pneumonia...   335    3e-119
  B7N3G7 Ureidoacrylate amidohydrolase RutB [Escherichia coli O17...   335    3e-119
  D3H124 Ureidoacrylate amidohydrolase RutB [Escherichia coli O44...   335    3e-119
  A7ZKB6 Ureidoacrylate amidohydrolase RutB [Escherichia coli O13...   334    5e-119
  B1LIZ4 Ureidoacrylate amidohydrolase RutB [Escherichia coli (st...   334    5e-119
  D3QPK4 Ureidoacrylate amidohydrolase RutB [Escherichia coli O55...   335    5e-119
  A1JMX8 Ureidoacrylate amidohydrolase RutB [Yersinia enterocolit...   334    7e-119
  D3RKL1 Ureidoacrylate amidohydrolase RutB [Klebsiella variicola...   334    8e-119
  C9QZ65 Ureidoacrylate amidohydrolase RutB [Escherichia coli (st...   333    1e-118
  C8UMM7 Ureidoacrylate amidohydrolase RutB [Escherichia coli O11...   333    1e-118
  C8TNC1 Ureidoacrylate amidohydrolase RutB [Escherichia coli O26...   333    1e-118
  P75897 Ureidoacrylate amidohydrolase RutB [Escherichia coli (st...   333    1e-118
  D2NGI8 Ureidoacrylate amidohydrolase RutB [Escherichia coli O15...   333    1e-118
  D5CE33 Ureidoacrylate amidohydrolase RutB [Enterobacter cloacae...   332    3e-118
  C6UPN3 Ureidoacrylate amidohydrolase RutB [Escherichia coli O15...   332    4e-118
  C8U5H3 Ureidoacrylate amidohydrolase RutB [Escherichia coli O10...   332    5e-118
  D2AC42 Ureidoacrylate amidohydrolase RutB [Shigella flexneri se...   330    5e-117
  C9Y0S6 Ureidoacrylate amidohydrolase RutB [Cronobacter turicens...   329    7e-117
  D5CZH1 Ureidoacrylate amidohydrolase RutB [Escherichia coli O18...   328    9e-117
  D4GEU5 Ureidoacrylate amidohydrolase RutB [Pantoea ananatis (st...   316    1e-111


> Q6FFZ6 Ureidoacrylate amidohydrolase RutB [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=245

 Score =  493 bits (1269),  Expect = 0.0
 Identities = 245/245 (100%), Positives = 245/245 (100%), Gaps = 0/245 (0%)

Query  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60
            MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT
Sbjct  1    MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT  60

Query  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120
            KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG
Sbjct  61   KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG  120

Query  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180
            KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
Sbjct  121  KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC  180

Query  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240
            VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ
Sbjct  181  VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ  240

Query  241  LAKTA  245
            LAKTA
Sbjct  241  LAKTA  245


> A8GCT5 Ureidoacrylate amidohydrolase RutB [Serratia proteamaculans 
(strain 568)]
Length=248

 Score =  336 bits (861),  Expect = 2e-119
 Identities = 159/217 (73%), Positives = 188/217 (87%), Gaps = 0/217 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI  AP++TALIVVDMQNAY S GGYLDLAGFD+S T PV+ NI++A++AA AA
Sbjct  23   LPARPEAIAFAPQETALIVVDMQNAYASQGGYLDLAGFDISATAPVIANIKRAISAARAA  82

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            GI+VI+F+NGWDNQYVEAGG GSPN+HKSNALKTMRK+PEL GKLLA+G WD++L+DELQ
Sbjct  83   GIKVIFFQNGWDNQYVEAGGQGSPNWHKSNALKTMRKRPELMGKLLARGDWDYDLVDELQ  142

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P++ DIV+ KPRYSGFFNT LDS+LR+ GI +LVF GIATNVCVESTLRDGFFLEYFG+ 
Sbjct  143  PQAGDIVLPKPRYSGFFNTQLDSLLRSYGIHHLVFTGIATNVCVESTLRDGFFLEYFGIV  202

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNT  234
            L DA +QAGP    +A++YNI+TFFGWVSD  SF NT
Sbjct  203  LADATHQAGPQFAQQAALYNIETFFGWVSDVDSFCNT  239


> B7MTF4 Ureidoacrylate amidohydrolase RutB [Escherichia coli O81 
(strain ED1a)]
Length=230

 Score =  335 bits (859),  Expect = 2e-119
 Identities = 160/214 (75%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+QTALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQTALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  217


> A6T7A1 Ureidoacrylate amidohydrolase RutB [Klebsiella pneumoniae 
subsp. pneumoniae (strain ATCC 700721 / MGH 78578)]
Length=236

 Score =  335 bits (859),  Expect = 3e-119
 Identities = 158/225 (70%), Positives = 191/225 (85%), Gaps = 0/225 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PE++  AP+Q+ALIVVDMQNAY S GGYLDLAGFDVS T+PV++NI  AV AA AA
Sbjct  4    LPARPESLSFAPQQSALIVVDMQNAYASQGGYLDLAGFDVSATRPVIDNINTAVAAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD+QYVEAGG GSPN+HKSNALKTMR++PELQGKLLAKGGWD++L+DEL 
Sbjct  64   GMLIIWFQNGWDDQYVEAGGPGSPNYHKSNALKTMRQRPELQGKLLAKGGWDYQLVDELT  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFG+ 
Sbjct  124  PQEGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGIV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQLA  242
            L+DA +QAGP    +A+++NI+TFFGWVSD +SF +       LA
Sbjct  184  LEDATHQAGPAFAQQAALFNIETFFGWVSDVESFCHALSPAAPLA  228


> B7N3G7 Ureidoacrylate amidohydrolase RutB [Escherichia coli O17:K52:H18 
(strain UMN026 / ExPEC)]
Length=230

 Score =  335 bits (858),  Expect = 3e-119
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 0/215 (0%)

Query  17   VLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHA  76
            +L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA A
Sbjct  3    ILTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARA  62

Query  77   AGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDEL  136
            AG+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL
Sbjct  63   AGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDEL  122

Query  137  QPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGV  196
             P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV
Sbjct  123  VPQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGV  182

Query  197  ALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
             L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  183  VLEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  217


> D3H124 Ureidoacrylate amidohydrolase RutB [Escherichia coli O44:H18 
(strain 042 / EAEC)]
Length=230

 Score =  335 bits (858),  Expect = 3e-119
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 0/215 (0%)

Query  17   VLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHA  76
            +L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA A
Sbjct  3    ILTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARA  62

Query  77   AGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDEL  136
            AG+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL
Sbjct  63   AGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDEL  122

Query  137  QPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGV  196
             P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV
Sbjct  123  VPQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGV  182

Query  197  ALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
             L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  183  VLEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  217


> A7ZKB6 Ureidoacrylate amidohydrolase RutB [Escherichia coli O139:H28 
(strain E24377A / ETEC)]
Length=231

 Score =  334 bits (857),  Expect = 5e-119
 Identities = 159/214 (74%), Positives = 187/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  5    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  64

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  65   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  124

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  125  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  184

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP  + +A+++NI+TFFGWVSD ++F
Sbjct  185  LEDATHQAGPEFVQKAALFNIETFFGWVSDVETF  218


> B1LIZ4 Ureidoacrylate amidohydrolase RutB [Escherichia coli (strain 
SMS-3-5 / SECEC)]
Length=231

 Score =  334 bits (857),  Expect = 5e-119
 Identities = 160/214 (75%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+QTALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  5    LTARPEAITFDPQQTALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  64

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  65   GMLIIWFQNGWDAQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  124

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  125  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  184

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  185  LEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  218


> D3QPK4 Ureidoacrylate amidohydrolase RutB [Escherichia coli O55:H7 
(strain CB9615 / EPEC)]
Length=244

 Score =  335 bits (858),  Expect = 5e-119
 Identities = 160/219 (73%), Positives = 188/219 (86%), Gaps = 0/219 (0%)

Query  13   GTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVT  72
            G    L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVT
Sbjct  13   GMMTTLTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVT  72

Query  73   AAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFEL  132
            AA AAG+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L
Sbjct  73   AARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQL  132

Query  133  IDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLE  192
            +DEL P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLE
Sbjct  133  VDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLE  192

Query  193  YFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            YFGV L+DA +QAGP  + +A+++NI+TFFGWVSD ++F
Sbjct  193  YFGVVLEDATHQAGPEFVQKAALFNIETFFGWVSDVETF  231


> A1JMX8 Ureidoacrylate amidohydrolase RutB [Yersinia enterocolitica 
serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)]
Length=230

 Score =  334 bits (856),  Expect = 7e-119
 Identities = 160/229 (70%), Positives = 190/229 (83%), Gaps = 0/229 (0%)

Query  17   VLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHA  76
            +L A PE I      +ALIVVDMQNAY S GGYLDLAGFDVS T P++ NI++A+TAA A
Sbjct  2    ILNARPEPIAFPTSASALIVVDMQNAYASEGGYLDLAGFDVSATAPIITNIKRAITAARA  61

Query  77   AGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDEL  136
            AGIQVI+F+NGWD QYVEAGG GSPN+HKSNALKTMRKQPEL GKLLAKG WD+ L+DEL
Sbjct  62   AGIQVIFFQNGWDPQYVEAGGEGSPNWHKSNALKTMRKQPELMGKLLAKGDWDYALVDEL  121

Query  137  QPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGV  196
            QP++ DIVI KPRYSGFFNT LDS+LRA+GI +L+F GIATNVCVESTLRDGFF EYFGV
Sbjct  122  QPQAGDIVIAKPRYSGFFNTQLDSILRAKGIHHLIFTGIATNVCVESTLRDGFFFEYFGV  181

Query  197  ALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQLAKTA  245
             L+DA +QAGP    +A++YNI+TFFGWVSD ++F N    + QL+++A
Sbjct  182  VLEDATHQAGPDFAQKAALYNIETFFGWVSDVETFCNCIAPSAQLSQSA  230


> D3RKL1 Ureidoacrylate amidohydrolase RutB [Klebsiella variicola 
(strain At-22)]
Length=236

 Score =  334 bits (856),  Expect = 8e-119
 Identities = 156/214 (73%), Positives = 188/214 (88%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PE++  AP+Q+ALIVVDMQNAY S GGYLDLAGFDVS T+PV++NI  AV AA AA
Sbjct  4    LPARPESLTFAPQQSALIVVDMQNAYASQGGYLDLAGFDVSATRPVIDNINTAVAAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD+QYVEAGG GSPN+HKSNALKTMR++PELQGKLLAKGGWD++L+DEL 
Sbjct  64   GMLIIWFQNGWDDQYVEAGGPGSPNYHKSNALKTMRQRPELQGKLLAKGGWDYQLVDELT  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFG+ 
Sbjct  124  PQEGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGIV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD +SF
Sbjct  184  LEDATHQAGPAFAQQAALFNIETFFGWVSDVESF  217


> C9QZ65 Ureidoacrylate amidohydrolase RutB [Escherichia coli (strain 
ATCC 33849 / DSM 4235 / NCIB 12045 / K12 / DH1)]
Length=230

 Score =  333 bits (855),  Expect = 1e-118
 Identities = 159/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPKFAQKAALFNIETFFGWVSDVETF  217


> C8UMM7 Ureidoacrylate amidohydrolase RutB [Escherichia coli O111:H- 
(strain 11128 / EHEC)]
Length=230

 Score =  333 bits (855),  Expect = 1e-118
 Identities = 159/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  217


> C8TNC1 Ureidoacrylate amidohydrolase RutB [Escherichia coli O26:H11 
(strain 11368 / EHEC)]
Length=230

 Score =  333 bits (855),  Expect = 1e-118
 Identities = 159/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  217


> P75897 Ureidoacrylate amidohydrolase RutB [Escherichia coli (strain 
K12)]
Length=230

 Score =  333 bits (855),  Expect = 1e-118
 Identities = 159/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPKFAQKAALFNIETFFGWVSDVETF  217


> D2NGI8 Ureidoacrylate amidohydrolase RutB [Escherichia coli O150:H5 
(strain SE15)]
Length=230

 Score =  333 bits (855),  Expect = 1e-118
 Identities = 159/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  217


> D5CE33 Ureidoacrylate amidohydrolase RutB [Enterobacter cloacae 
subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 
/ NCDC 279-56)]
Length=229

 Score =  332 bits (852),  Expect = 3e-118
 Identities = 162/228 (71%), Positives = 192/228 (84%), Gaps = 2/228 (1%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI  +  Q+ALIVVDMQNAY S GGYLDLAGFDVS T+PV+ENI+ AV AA AA
Sbjct  4    LNARPEAITFSAPQSALIVVDMQNAYASPGGYLDLAGFDVSATRPVIENIKTAVAAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD+QYVEAGG GSPNFHKSNALKTMRK+PELQGKLLAKGGWD++L+DEL 
Sbjct  64   GMLIIWFQNGWDDQYVEAGGPGSPNFHKSNALKTMRKRPELQGKLLAKGGWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P++ DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PEAGDIVLPKPRYSGFFNTPLDSLLRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQLAKTA  245
            L+DA +QAGP    +A+++NI+TFFGWVS+   F +    N  LA+ A
Sbjct  184  LEDATHQAGPEFAQKAALFNIETFFGWVSNVADFCDAL--NPPLARIA  229


> C6UPN3 Ureidoacrylate amidohydrolase RutB [Escherichia coli O157:H7 
(strain TW14359 / EHEC)]
Length=230

 Score =  332 bits (851),  Expect = 4e-118
 Identities = 158/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF  IATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTSIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP  + +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPEFVQKAALFNIETFFGWVSDVETF  217


> C8U5H3 Ureidoacrylate amidohydrolase RutB [Escherichia coli O103:H2 
(strain 12009 / EHEC)]
Length=230

 Score =  332 bits (850),  Expect = 5e-118
 Identities = 158/214 (74%), Positives = 185/214 (86%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+Q+ALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA AA
Sbjct  4    LTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAA  63

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMR QP+LQGKLLAKG WD++L+DEL 
Sbjct  64   GMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRNQPQLQGKLLAKGSWDYQLVDELV  123

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  124  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  183

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  184  LEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  217


> D2AC42 Ureidoacrylate amidohydrolase RutB [Shigella flexneri 
serotype X (strain 2002017)]
Length=244

 Score =  330 bits (845),  Expect = 5e-117
 Identities = 158/219 (72%), Positives = 186/219 (85%), Gaps = 0/219 (0%)

Query  13   GTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVT  72
            G    L A PEAI   P+Q+A IVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVT
Sbjct  13   GMMTTLTARPEAITFDPQQSAQIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVT  72

Query  73   AAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFEL  132
            AA AAG+ +I+F+NGWD QYVEAGG GSPNFHKSNALKTMRKQP+LQGKLLAKG WD++L
Sbjct  73   AARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQL  132

Query  133  IDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLE  192
            +DEL P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLE
Sbjct  133  VDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLE  192

Query  193  YFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            +FGV L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  193  HFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  231


> C9Y0S6 Ureidoacrylate amidohydrolase RutB [Cronobacter turicensis 
(strain DSM 18703 / LMG 23827 / z3032)]
Length=232

 Score =  329 bits (843),  Expect = 7e-117
 Identities = 157/214 (73%), Positives = 182/214 (85%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEA+  APEQ+ALIVVDMQNAY S GGYLDLAGFDVS T PV+ENI+ AV AA  A
Sbjct  6    LMARPEALTFAPEQSALIVVDMQNAYASQGGYLDLAGFDVSTTAPVIENIKTAVAAAREA  65

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +++F+NGWD+ Y+EAGG GSPNFHKSNALKTMR++PEL GKLLAKGGWD++L+DEL 
Sbjct  66   GMTIVWFQNGWDSDYLEAGGPGSPNFHKSNALKTMRRRPELHGKLLAKGGWDYQLVDELT  125

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P   DIV+ KPRYSGFFNT LDSMLRAR IR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  126  PLPGDIVLPKPRYSGFFNTPLDSMLRARNIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  185

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD Q F
Sbjct  186  LEDATHQAGPPFAQQAALFNIETFFGWVSDVQRF  219


> D5CZH1 Ureidoacrylate amidohydrolase RutB [Escherichia coli O18:K1:H7 
(strain IHE3034 / ExPEC)]
Length=231

 Score =  328 bits (842),  Expect = 9e-117
 Identities = 157/214 (73%), Positives = 183/214 (86%), Gaps = 0/214 (0%)

Query  18   LKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAA  77
            L A PEAI   P+QTALIVVDMQNAY + GGYLDLAGFDVS T+PV+ NIQ AVTAA  A
Sbjct  5    LTARPEAITFDPQQTALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARTA  64

Query  78   GIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQ  137
            G+ +I+F+NGWD QYVEAGG GSPN+HKSNALKTMR QP LQGKLLAKG WD++L+DEL 
Sbjct  65   GMLIIWFQNGWDEQYVEAGGPGSPNYHKSNALKTMRNQPLLQGKLLAKGSWDYQLVDELV  124

Query  138  PKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVESTLRDGFFLEYFGVA  197
            P+  DIV+ KPRYSGFFNT LDS+LR+RGIR+LVF GIATNVCVESTLRDGFFLEYFGV 
Sbjct  125  PQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVV  184

Query  198  LDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            L+DA +QAGP    +A+++NI+TFFGWVSD ++F
Sbjct  185  LEDATHQAGPEFAQKAALFNIETFFGWVSDVETF  218


> D4GEU5 Ureidoacrylate amidohydrolase RutB [Pantoea ananatis (strain 
LMG 20103)]
Length=250

 Score =  316 bits (810),  Expect = 1e-111
 Identities = 156/229 (68%), Positives = 180/229 (79%), Gaps = 0/229 (0%)

Query  3    TVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKP  62
            TV+    + AG  RVL A PEAI   P+QTALIVVDMQNAY S GGYLDLAGFDVS T P
Sbjct  9    TVVRRAPDNAGEERVLAARPEAIGFTPQQTALIVVDMQNAYASQGGYLDLAGFDVSATAP  68

Query  63   VVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQGKL  122
            V+ NI+ A+ AA AAGI+VI+F+NGWDNQYVEAGG   P       LKTMRK+PEL GKL
Sbjct  69   VIANIKVAIAAARAAGIKVIFFQNGWDNQYVEAGGRARPTSINPMRLKTMRKRPELMGKL  128

Query  123  LAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVCVE  182
            LAKG WD++L+DELQP+  DIV+ KPRYSGFFNT LDS+LR+ GI +LVF GIATNVCVE
Sbjct  129  LAKGDWDYDLVDELQPQPGDIVLPKPRYSGFFNTQLDSLLRSYGIHHLVFTGIATNVCVE  188

Query  183  STLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSF  231
            STLRDGFFLEYFGV L+DA +QAGP    +A++YNI+TFFGWVS    F
Sbjct  189  STLRDGFFLEYFGVVLEDATHQAGPEFAQKAAIYNIETFFGWVSSVSHF  237



Lambda      K        H        a         alpha
   0.322    0.136    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883750


  Database: cac041b3d81caeb0ec8744359dc8fa87.SwissProt.fasta
    Posted date:  Sep 19, 2020  11:13 AM
  Number of letters in database: 5,387
  Number of sequences in database:  23



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40