ACIAD3188 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: cb9e2bbf18a879aa9340a0f8a15e9d66.TrEMBL.fasta
           14 sequences; 1,802 total letters



Query= ACIAD3188

Length=131
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F7U2 Uncharacterized protein [Acinetobacter baylyi (strain AT...   274    4e-99
  A0A0M1I877 Uncharacterized protein [Acinetobacter sp. C15]           113    5e-36
  N9BXK5 Uncharacterized protein [Acinetobacter soli NIPH 2899]        113    5e-36
  A0A1P8EJY7 Uncharacterized protein [Acinetobacter soli]              110    4e-35
  A0A143IUR7 Uncharacterized protein [Acinetobacter pittii]            106    2e-33
  A0A010K1V3 Uncharacterized protein [Acinetobacter sp. 1542444]       105    3e-33
  A0A010UI76 Uncharacterized protein [Acinetobacter sp. 263903-2]      105    3e-33
  A0A009YP30 Uncharacterized protein [Acinetobacter sp. 479375]        105    4e-33
  F0KQ02 Uncharacterized protein [Acinetobacter calcoaceticus (st...   105    5e-33
  A0A009H1K7 Uncharacterized protein [Acinetobacter sp. 1295259]       105    6e-33
  A0A255U5Q4 Uncharacterized protein [Acinetobacter sp. BS1]           105    6e-33
  A0A127KCN8 Uncharacterized protein [Acinetobacter sp. DUT-2]         105    6e-33
  A0A1S8XE23 Uncharacterized protein [Acinetobacter pittii]            105    6e-33
  A0A1A0GD63 Uncharacterized protein [Acinetobacter calcoaceticus]     105    6e-33


> Q6F7U2 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=130

 Score =  274 bits (700),  Expect = 4e-99
 Identities = 130/130 (100%), Positives = 130/130 (100%), Gaps = 0/130 (0%)

Query  1    MCMANQLRFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPK  60
            MCMANQLRFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPK
Sbjct  1    MCMANQLRFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPK  60

Query  61   INTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIYSQNPSLSLIIWCDQVSQQEW  120
            INTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIYSQNPSLSLIIWCDQVSQQEW
Sbjct  61   INTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIYSQNPSLSLIIWCDQVSQQEW  120

Query  121  KRLKVMTKLL  130
            KRLKVMTKLL
Sbjct  121  KRLKVMTKLL  130


> A0A0M1I877 Uncharacterized protein [Acinetobacter sp. C15]
Length=128

 Score =  113 bits (282),  Expect = 5e-36
 Identities = 53/127 (42%), Positives = 81/127 (64%), Gaps = 0/127 (0%)

Query  3    MANQLRFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPKIN  62
            MA Q  F LK+SKLA+LFQL +   +  ++W +   W+W  + +  LI +  F R+P++ 
Sbjct  1    MAKQPYFALKRSKLALLFQLMIFGSISGLLWQICPLWLWLLLNILMLISFAMFLRRPRVM  60

Query  63   TIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIYSQNPSLSLIIWCDQVSQQEWKR  122
             + QLDQ+ WS    +  + YS  L+R+IDH++YMI+ +     S++IW DQV QQ+WKR
Sbjct  61   AVGQLDQQLWSCHASDSAQPYSIVLERVIDHELYMILRTVPSRASMVIWRDQVIQQDWKR  120

Query  123  LKVMTKL  129
            LK + KL
Sbjct  121  LKRLAKL  127


> N9BXK5 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=128

 Score =  113 bits (282),  Expect = 5e-36
 Identities = 53/127 (42%), Positives = 81/127 (64%), Gaps = 0/127 (0%)

Query  3    MANQLRFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPKIN  62
            MA Q  F LK+SKLA+LFQL +   +  ++W +   W+W  + +  LI +  F R+P++ 
Sbjct  1    MAKQPYFALKRSKLALLFQLMIFGSISGLLWQICPLWLWLLLNILMLISFAMFLRRPRVM  60

Query  63   TIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIYSQNPSLSLIIWCDQVSQQEWKR  122
             + QLDQ+ WS    +  + YS  L+R+IDH++YMI+ +     S++IW DQV QQ+WKR
Sbjct  61   AVGQLDQQLWSCHASDSAQPYSIVLERVIDHELYMILRTVPSRASMVIWRDQVIQQDWKR  120

Query  123  LKVMTKL  129
            LK + KL
Sbjct  121  LKRLAKL  127


> A0A1P8EJY7 Uncharacterized protein [Acinetobacter soli]
Length=128

 Score =  110 bits (276),  Expect = 4e-35
 Identities = 52/127 (41%), Positives = 80/127 (63%), Gaps = 0/127 (0%)

Query  3    MANQLRFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPKIN  62
            MA Q  F LK+SKLA+LFQL +   +  ++W +   W+W  + V  LI +  F R+P++ 
Sbjct  1    MAKQPYFALKRSKLALLFQLMIFGSISGLLWQICPLWLWLVLNVLMLISFAMFLRRPRVM  60

Query  63   TIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIYSQNPSLSLIIWCDQVSQQEWKR  122
             + QLDQ+ WS    +  + YS  L+R+IDH++YMI+ +     S+++W DQV QQ+WK 
Sbjct  61   AVGQLDQQLWSCHASDSAQPYSIVLERVIDHELYMILRTVPSRASMVVWRDQVMQQDWKC  120

Query  123  LKVMTKL  129
            LK + KL
Sbjct  121  LKRLAKL  127


> A0A143IUR7 Uncharacterized protein [Acinetobacter pittii]
Length=129

 Score =  106 bits (265),  Expect = 2e-33
 Identities = 48/128 (38%), Positives = 85/128 (66%), Gaps = 1/128 (1%)

Query  3    MANQLRFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPKIN  62
            M  +L F+LK S+++++FQL + L +  +++ L     W    +   IG+ FF +Q +I+
Sbjct  1    MIKELNFELKYSRVSVIFQLFIGLGLAILLYQLLKPIWWLCAVILLFIGFIFFLKQAQIS  60

Query  63   TIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQVSQQEWK  121
             IE LDQK WS+ Y  ++++Y  ++ +LID+Q++++IY  ++P+   I+W DQ+  Q+WK
Sbjct  61   QIEYLDQKLWSVAYFSKKEIYRAEITKLIDYQLFVVIYLEESPTNIAIVWFDQLPIQQWK  120

Query  122  RLKVMTKL  129
            RLKV+ KL
Sbjct  121  RLKVLEKL  128


> A0A010K1V3 Uncharacterized protein [Acinetobacter sp. 1542444]
Length=129

 Score =  105 bits (263),  Expect = 3e-33
 Identities = 52/135 (39%), Positives = 87/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S+++++FQL        LL  +L  +WWL      CA+ +   IG+ FF
Sbjct  1    MIKELNFELKDSRVSVIFQLFVGLGLAILLYQLLTPIWWL------CAV-ILLFIGFIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y  ++++Y  ++ ++ID+Q++++IY  + P+   I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVTYFSKKEIYRAEITKIIDYQLFVVIYLEETPTNIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128


> A0A010UI76 Uncharacterized protein [Acinetobacter sp. 263903-2]
Length=129

 Score =  105 bits (263),  Expect = 3e-33
 Identities = 52/135 (39%), Positives = 87/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S ++++FQL        LL  +L  +WWL      CA+ +   IG+ FF
Sbjct  1    MIKELNFELKYSLVSVIFQLFVGLGLAILLYQLLTPIWWL------CAV-ILLFIGFIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y  ++++Y  ++ ++ID+Q++++IY  + P++  I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVAYFSKKEIYRAEITKIIDYQLFVVIYLEETPTIIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128


> A0A009YP30 Uncharacterized protein [Acinetobacter sp. 479375]
Length=127

 Score =  105 bits (262),  Expect = 4e-33
 Identities = 54/123 (44%), Positives = 81/123 (66%), Gaps = 0/123 (0%)

Query  8    RFQLKQSKLAILFQLTLLLVMLCMMWWLFNFWIWCAICVSALIGYFFFCRQPKINTIEQL  67
            +FQLK+S LA+LFQL +LL++  + + LF F++  +    A+I Y  F R+ K+ ++  L
Sbjct  5    QFQLKRSLLALLFQLGMLLLIGIIWFQLFPFYMSLSAIFLAIIAYLAFLRRSKMCSLAYL  64

Query  68   DQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIYSQNPSLSLIIWCDQVSQQEWKRLKVMT  127
            DQ  WS+Q+    K+   QL R+IDH IY+++Y +    S IIW DQVS  +WK+LKVM 
Sbjct  65   DQDLWSIQWRNHSKIEHVQLYRVIDHHIYIVLYFKQNRNSQIIWRDQVSLNQWKQLKVMA  124

Query  128  KLL  130
            KL+
Sbjct  125  KLV  127


> F0KQ02 Uncharacterized protein [Acinetobacter calcoaceticus (strain 
PHEA-2)]
Length=129

 Score =  105 bits (262),  Expect = 5e-33
 Identities = 52/135 (39%), Positives = 87/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S+++++FQL        LL  +L  +WWL      CA+ +   IG+ FF
Sbjct  1    MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTPIWWL------CAV-ILLFIGFIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y  ++++Y  ++ ++ID+Q++++IY  + P+   I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVTYFSKKEIYRAEITKIIDYQLFVVIYLEETPTNIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128


> A0A009H1K7 Uncharacterized protein [Acinetobacter sp. 1295259]
Length=129

 Score =  105 bits (261),  Expect = 6e-33
 Identities = 52/135 (39%), Positives = 87/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S+++++FQL        LL  +L ++WWL      CA+ +   IG  FF
Sbjct  1    MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTLIWWL------CAV-ILLFIGSIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y  ++++Y  ++ ++ID+Q++++IY  + P+   I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVAYFSKKEIYRAEITKIIDYQLFVVIYFEETPTNIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128


> A0A255U5Q4 Uncharacterized protein [Acinetobacter sp. BS1]
Length=129

 Score =  105 bits (261),  Expect = 6e-33
 Identities = 52/135 (39%), Positives = 87/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S+++++FQL        LL  +L  +WWL      CA+ +   IG+ FF
Sbjct  1    MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTPIWWL------CAV-ILLFIGFIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y  ++++Y  ++ ++ID+Q++++IY  + P+   I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVAYFSKKEIYRGEITKIIDYQLFVVIYLEETPTNIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128


> A0A127KCN8 Uncharacterized protein [Acinetobacter sp. DUT-2]
Length=129

 Score =  105 bits (261),  Expect = 6e-33
 Identities = 52/135 (39%), Positives = 87/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S+++++FQL        LL  +L  +WWL      CA+ +   IG+ FF
Sbjct  1    MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTPIWWL------CAV-ILLFIGFIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y  ++++Y  ++ ++ID+Q++++IY  + P+   I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVAYFSKKEIYRGEITKIIDYQLFVVIYLEETPTNIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128


> A0A1S8XE23 Uncharacterized protein [Acinetobacter pittii]
Length=129

 Score =  105 bits (261),  Expect = 6e-33
 Identities = 53/135 (39%), Positives = 86/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S+++++FQL        LL  +L  +WWL      CA+ V   IG+ FF
Sbjct  1    MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTPIWWL------CAV-VLLFIGFIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y   +++Y  ++ ++ID+Q++++IY  + P+   I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVAYFSEKEIYRAEITKIIDYQLFVVIYLEETPTNIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128


> A0A1A0GD63 Uncharacterized protein [Acinetobacter calcoaceticus]
Length=129

 Score =  105 bits (261),  Expect = 6e-33
 Identities = 53/135 (39%), Positives = 86/135 (64%), Gaps = 15/135 (11%)

Query  3    MANQLRFQLKQSKLAILFQL-------TLLLVMLCMMWWLFNFWIWCAICVSALIGYFFF  55
            M  +L F+LK S+++++FQL        LL  +L  +WWL      CA+ V   IG+ FF
Sbjct  1    MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTPIWWL------CAV-VLLFIGFIFF  53

Query  56   CRQPKINTIEQLDQKTWSLQYVEREKVYSFQLDRLIDHQIYMIIY-SQNPSLSLIIWCDQ  114
             +Q +I+ IE LDQK WS+ Y   +++Y  ++ ++ID+Q++++IY  + P+   I+W DQ
Sbjct  54   LKQAQISQIEYLDQKLWSVAYFSEKEIYRAEITKIIDYQLFVVIYLEETPTNIAIVWFDQ  113

Query  115  VSQQEWKRLKVMTKL  129
            +  Q+WKRLKV+ KL
Sbjct  114  LPIQQWKRLKVLEKL  128



Lambda      K        H        a         alpha
   0.338    0.142    0.495    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 136800


  Database: cb9e2bbf18a879aa9340a0f8a15e9d66.TrEMBL.fasta
    Posted date:  Sep 24, 2020  3:11 AM
  Number of letters in database: 1,802
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40