ACIAD3210 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 20f2dba4901b0f9cd5571e0c152b12b7.TrEMBL.fasta
           33 sequences; 2,967 total letters



Query= ACIAD3210

Length=86
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  N9QVQ0 30S ribosomal protein S17 [Acinetobacter ursingii NIPH 706]   166    1e-57
  N9C574 30S ribosomal protein S17 [Acinetobacter ursingii ANC 3649]   166    1e-57
  A0A009ZI46 30S ribosomal protein S17 [Acinetobacter sp. 479375]      166    1e-57
  K9BIA8 30S ribosomal protein S17 [Acinetobacter sp. WC-323]          164    4e-57
  A0A2R4ULQ1 30S ribosomal protein S17 [Acinetobacter junii]           164    4e-57
  N8WEA2 30S ribosomal protein S17 [Acinetobacter sp. CIP 56.2]        164    4e-57
  N9SZI4 30S ribosomal protein S17 [Acinetobacter sp. CIP 70.18]       164    4e-57
  A0A013RW71 30S ribosomal protein S17 [Acinetobacter baumannii 5...   163    1e-56
  R8YFQ4 30S ribosomal protein S17 [Acinetobacter pittii ANC 4050]     163    1e-56
  A0A010JMC2 30S ribosomal protein S17 [Acinetobacter sp. 1542444]     163    1e-56
  A0A1H8QNV2 30S ribosomal protein S17 [Acinetobacter sp. UNC434C...   163    1e-56
  A0A2U3MUH7 30S ribosomal protein S17 [Acinetobacter sp. KPC-SM-21]   162    2e-56
  A0A014AXZ4 30S ribosomal protein S17 [Acinetobacter sp. 25977_8]     162    2e-56
  D8JMZ6 30S ribosomal protein S17 [Acinetobacter oleivorans (str...   162    2e-56
  A0A014DZD3 30S ribosomal protein S17 [Acinetobacter sp. 25977_6]     162    2e-56
  A0A140QTF2 30S ribosomal protein S17 [Acinetobacter sp. 216872]      162    2e-56
  A0A0J1A4M4 30S ribosomal protein S17 [Acinetobacter baumannii M...   162    2e-56
  N9FNZ0 30S ribosomal protein S17 [Acinetobacter beijerinckii AN...   162    2e-56
  N9RHL6 30S ribosomal protein S17 [Acinetobacter sp. NIPH 2100]       162    2e-56
  N8ZW28 30S ribosomal protein S17 [Acinetobacter venetianus (str...   162    2e-56
  N9LZE3 30S ribosomal protein S17 [Acinetobacter sp. ANC 3929]        162    2e-56
  A0A009HQX2 30S ribosomal protein S17 [Acinetobacter baumannii (...   162    3e-56
  N8ZJC7 30S ribosomal protein S17 [Acinetobacter gerneri DSM 149...   161    5e-56
  A0A1E7R322 30S ribosomal protein S17 [Acinetobacter qingfengensis]   161    5e-56
  N8UHC3 30S ribosomal protein S17 [Acinetobacter sp. CIP 102129]      161    7e-56
  A0A0A3W4A5 30S ribosomal protein S17 [Acinetobacter sp. HR7]         160    1e-55
  A0A2L0HUX7 30S ribosomal protein S17 [Acinetobacter sp. ACNIH2]      160    1e-55
  R9AM28 30S ribosomal protein S17 [Acinetobacter tandoii DSM 149...   160    1e-55
  A0A1Z9Z2W9 30S ribosomal protein S17 [Acinetobacter populi]          160    2e-55
  E2RXT5 30S ribosomal protein S17 [Pseudomonas aeruginosa]            133    6e-45
  O74663 RPYS18 [Rhizopus oryzae]                                     48.9    2e-12
  A0A0K2CU27 40S ribosomal protein S11 [Spodoptera frugiperda]        40.8    3e-09
  Q90YR3 40S ribosomal protein S11 [Ictalurus punctatus]              37.0    8e-08


> N9QVQ0 30S ribosomal protein S17 [Acinetobacter ursingii NIPH 
706]
Length=85

 Score =  166 bits (419),  Expect = 1e-57
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVEVAAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEVAAE  85


> N9C574 30S ribosomal protein S17 [Acinetobacter ursingii ANC 
3649]
Length=85

 Score =  166 bits (419),  Expect = 1e-57
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVEVAAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEVAAE  85


> A0A009ZI46 30S ribosomal protein S17 [Acinetobacter sp. 479375]
Length=85

 Score =  166 bits (419),  Expect = 1e-57
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVEVAAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEVAAE  85


> K9BIA8 30S ribosomal protein S17 [Acinetobacter sp. WC-323]
Length=85

 Score =  164 bits (415),  Expect = 4e-57
 Identities = 84/85 (99%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A2R4ULQ1 30S ribosomal protein S17 [Acinetobacter junii]
Length=85

 Score =  164 bits (415),  Expect = 4e-57
 Identities = 84/85 (99%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N8WEA2 30S ribosomal protein S17 [Acinetobacter sp. CIP 56.2]
Length=85

 Score =  164 bits (415),  Expect = 4e-57
 Identities = 84/85 (99%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N9SZI4 30S ribosomal protein S17 [Acinetobacter sp. CIP 70.18]
Length=85

 Score =  164 bits (415),  Expect = 4e-57
 Identities = 84/85 (99%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A013RW71 30S ribosomal protein S17 [Acinetobacter baumannii 
573719]
Length=85

 Score =  163 bits (412),  Expect = 1e-56
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> R8YFQ4 30S ribosomal protein S17 [Acinetobacter pittii ANC 4050]
Length=85

 Score =  163 bits (412),  Expect = 1e-56
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A010JMC2 30S ribosomal protein S17 [Acinetobacter sp. 1542444]
Length=85

 Score =  163 bits (412),  Expect = 1e-56
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A1H8QNV2 30S ribosomal protein S17 [Acinetobacter sp. UNC434CL69Tsu2S25]
Length=85

 Score =  163 bits (412),  Expect = 1e-56
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A2U3MUH7 30S ribosomal protein S17 [Acinetobacter sp. KPC-SM-21]
Length=85

 Score =  162 bits (411),  Expect = 2e-56
 Identities = 83/85 (98%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN AKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNTAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A014AXZ4 30S ribosomal protein S17 [Acinetobacter sp. 25977_8]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> D8JMZ6 30S ribosomal protein S17 [Acinetobacter oleivorans (strain 
JCM 16667 / KCTC 23045 / DR1)]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A014DZD3 30S ribosomal protein S17 [Acinetobacter sp. 25977_6]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A140QTF2 30S ribosomal protein S17 [Acinetobacter sp. 216872]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A0J1A4M4 30S ribosomal protein S17 [Acinetobacter baumannii 
MRSN 3527]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N9FNZ0 30S ribosomal protein S17 [Acinetobacter beijerinckii 
ANC 3835]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 83/85 (98%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK GDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKTGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N9RHL6 30S ribosomal protein S17 [Acinetobacter sp. NIPH 2100]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 83/85 (98%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK GDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKTGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N8ZW28 30S ribosomal protein S17 [Acinetobacter venetianus (strain 
ATCC 31012 / CIP 110063 / RAG-1)]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 83/85 (98%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK GDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKTGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N9LZE3 30S ribosomal protein S17 [Acinetobacter sp. ANC 3929]
Length=85

 Score =  162 bits (410),  Expect = 2e-56
 Identities = 83/85 (98%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK GDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKTGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A009HQX2 30S ribosomal protein S17 [Acinetobacter baumannii 
(strain 1295743)]
Length=85

 Score =  162 bits (409),  Expect = 3e-56
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN+AK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNIAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N8ZJC7 30S ribosomal protein S17 [Acinetobacter gerneri DSM 14967 
= CIP 107464]
Length=85

 Score =  161 bits (408),  Expect = 5e-56
 Identities = 82/85 (96%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN AKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNTAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A1E7R322 30S ribosomal protein S17 [Acinetobacter qingfengensis]
Length=85

 Score =  161 bits (408),  Expect = 5e-56
 Identities = 82/85 (96%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEK VRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GDLV
Sbjct  1   MSEKVVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> N8UHC3 30S ribosomal protein S17 [Acinetobacter sp. CIP 102129]
Length=85

 Score =  161 bits (407),  Expect = 7e-56
 Identities = 82/85 (96%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTG+VVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK GDLV
Sbjct  1   MSEKTVRTLTGRVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKTGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A0A0A3W4A5 30S ribosomal protein S17 [Acinetobacter sp. HR7]
Length=85

 Score =  160 bits (405),  Expect = 1e-55
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN AKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNTAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTK+WTLVEVVE AAE
Sbjct  61  TIKESRPISKTKSWTLVEVVEAAAE  85


> A0A2L0HUX7 30S ribosomal protein S17 [Acinetobacter sp. ACNIH2]
Length=85

 Score =  160 bits (405),  Expect = 1e-55
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN AKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNTAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTK+WTLVEVVE AAE
Sbjct  61  TIKESRPISKTKSWTLVEVVEAAAE  85


> R9AM28 30S ribosomal protein S17 [Acinetobacter tandoii DSM 14970 
= CIP 107469]
Length=85

 Score =  160 bits (405),  Expect = 1e-55
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN AKLGD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNTAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTK+WTLVEVVE AAE
Sbjct  61  TIKESRPISKTKSWTLVEVVEAAAE  85


> A0A1Z9Z2W9 30S ribosomal protein S17 [Acinetobacter populi]
Length=85

 Score =  160 bits (404),  Expect = 2e-55
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSE+TVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENN AKLGD+V
Sbjct  1   MSEQTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNTAKLGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> E2RXT5 30S ribosomal protein S17 [Pseudomonas aeruginosa]
Length=88

 Score =  133 bits (335),  Expect = 6e-45
 Identities = 60/84 (71%), Positives = 78/84 (93%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           ++KTVRTLTG+VVSDKMDK++ VLIERRV+HP+YGK ++RSTKLHAHDE+N  ++GDLVT
Sbjct  4   AQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRSTKLHAHDESNQCRIGDLVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTKAWTLV++VE A E
Sbjct  64  IRETRPLAKTKAWTLVDIVERAVE  87


> O74663 RPYS18 [Rhizopus oryzae]
Length=103

 Score = 48.9 bits (115),  Expect = 2e-12
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query  7   RTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHD----ENNVAKLGDLVTI  62
           R LTG VVS KM +++VV  +     P Y +  +R   + AH     +N   ++GD+VTI
Sbjct  14  RILTGVVVSTKMKRTLVVRRDYLHYIPKYNRYEKRHKNISAHVSPAFDNQAIQVGDMVTI  73

Query  63  KESRPISKTKAWTLVEV  79
            + RP+SKT  + +++V
Sbjct  74  GQCRPLSKTVRFNVIKV  90


> A0A0K2CU27 40S ribosomal protein S11 [Spodoptera frugiperda]
Length=152

 Score = 40.8 bits (94),  Expect = 3e-09
 Identities = 26/77 (34%), Positives = 41/77 (53%), Gaps = 2/77 (3%)

Query  7    RTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDEN--NVAKLGDLVTIKE  64
            R LTG V   KM ++IV+  +     P Y +  +R   +  H        +LGD+VTI E
Sbjct  65   RILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVELGDIVTIGE  124

Query  65   SRPISKTKAWTLVEVVE  81
             RP+SKT  + +++V +
Sbjct  125  CRPLSKTIRFNVLKVTK  141


> Q90YR3 40S ribosomal protein S11 [Ictalurus punctatus]
Length=159

 Score = 37.0 bits (84),  Expect = 8e-08
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query  7    RTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK------LGDLV  60
            R L+G V   KM ++IV+    R  +  Y +   R  K H +   +++       +GD+V
Sbjct  72   RILSGVVTKMKMQRTIVI----RRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVTVGDIV  127

Query  61   TIKESRPISKTKAWTLVEVVEVA  83
            T+ E RP+SKT  + +++V + A
Sbjct  128  TVGECRPLSKTVRFNVLKVTKAA  150



Lambda      K        H        a         alpha
   0.321    0.132    0.364    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 114570


  Database: 20f2dba4901b0f9cd5571e0c152b12b7.TrEMBL.fasta
    Posted date:  Sep 18, 2020  3:29 PM
  Number of letters in database: 2,967
  Number of sequences in database:  33



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40