ACIAD3210 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2e83a3f7e36e30c43abde0c43090737f.SwissProt.fasta
           36 sequences; 3,230 total letters



Query= ACIAD3210

Length=86
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F7S1 30S ribosomal protein S17 [Acinetobacter baylyi (strain ...   166    1e-57
  B7IA30 30S ribosomal protein S17 [Acinetobacter baumannii (stra...   162    3e-56
  B2HZ99 30S ribosomal protein S17 [Acinetobacter baumannii (stra...   162    3e-56
  B0VQS7 30S ribosomal protein S17 [Acinetobacter baumannii (stra...   162    3e-56
  A3M975 30S ribosomal protein S17 [Acinetobacter baumannii (stra...   162    3e-56
  B0V6X7 30S ribosomal protein S17 [Acinetobacter baumannii (stra...   162    3e-56
  A6UZJ7 30S ribosomal protein S17 [Pseudomonas aeruginosa (strai...   133    6e-45
  B7V653 30S ribosomal protein S17 [Pseudomonas aeruginosa (strai...   133    6e-45
  Q02T71 30S ribosomal protein S17 [Pseudomonas aeruginosa (strai...   133    6e-45
  Q9HWE4 30S ribosomal protein S17 [Pseudomonas aeruginosa (strai...   133    6e-45
  Q1IFV7 30S ribosomal protein S17 [Pseudomonas entomophila (stra...   129    2e-43
  B0KK76 30S ribosomal protein S17 [Pseudomonas putida (strain GB...   129    2e-43
  B1JDX5 30S ribosomal protein S17 [Pseudomonas putida (strain W6...   129    2e-43
  C1DKM2 30S ribosomal protein S17 [Azotobacter vinelandii (strai...   129    2e-43
  A4XZ81 30S ribosomal protein S17 [Pseudomonas mendocina (strain...   129    2e-43
  A5VXQ6 30S ribosomal protein S17 [Pseudomonas putida (strain AT...   128    5e-43
  Q88QM6 30S ribosomal protein S17 [Pseudomonas putida (strain AT...   128    5e-43
  A4VHN9 30S ribosomal protein S17 [Pseudomonas stutzeri (strain ...   128    5e-43
  Q48D45 30S ribosomal protein S17 [Pseudomonas savastanoi pv. ph...   127    2e-42
  Q889W2 30S ribosomal protein S17 [Pseudomonas syringae pv. toma...   127    2e-42
  Q4ZMQ3 30S ribosomal protein S17 [Pseudomonas syringae pv. syri...   127    2e-42
  C3K2W7 30S ribosomal protein S17 [Pseudomonas fluorescens (stra...   127    2e-42
  Q4K542 30S ribosomal protein S17 [Pseudomonas fluorescens (stra...   127    2e-42
  Q3K5Z7 30S ribosomal protein S17 [Pseudomonas fluorescens (stra...   127    2e-42
  P55829 30S ribosomal protein S17 [Aggregatibacter actinomycetem...   120    5e-40
  P0AG63 30S ribosomal protein S17 [Escherichia coli (strain K12)]     114    1e-37
  P46175 30S ribosomal protein S17 [Buchnera aphidicola subsp. Ac...   111    3e-36
  P38519 30S ribosomal protein S17 [Thermotoga maritima (strain A...  99.0    3e-31
  P0A4B3 30S ribosomal protein S17 [Streptococcus pneumoniae sero...  95.9    3e-30
  P0A4B4 30S ribosomal protein S17 [Streptococcus pneumoniae (str...  95.9    3e-30
  P23828 30S ribosomal protein S17 [Geobacillus stearothermophilus]   94.4    1e-29
  P12874 30S ribosomal protein S17 [Bacillus subtilis (strain 168)]   92.8    5e-29
  O06051 30S ribosomal protein S17 [Mycobacterium bovis (strain A...  91.7    4e-28
  P0DOY7 30S ribosomal protein S17 [Thermus thermophilus (strain ...  85.5    5e-26
  P24321 30S ribosomal protein S17 [Thermus thermophilus]             85.5    5e-26
  O31164 30S ribosomal protein S17 [Spiroplasma citri]                82.8    3e-25


> Q6F7S1 30S ribosomal protein S17 [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=85

 Score =  166 bits (419),  Expect = 1e-57
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVEVAAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEVAAE  85


> B7IA30 30S ribosomal protein S17 [Acinetobacter baumannii (strain 
AB0057)]
Length=85

 Score =  162 bits (410),  Expect = 3e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> B2HZ99 30S ribosomal protein S17 [Acinetobacter baumannii (strain 
ACICU)]
Length=85

 Score =  162 bits (410),  Expect = 3e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> B0VQS7 30S ribosomal protein S17 [Acinetobacter baumannii (strain 
SDF)]
Length=85

 Score =  162 bits (410),  Expect = 3e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A3M975 30S ribosomal protein S17 [Acinetobacter baumannii (strain 
ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)]
Length=85

 Score =  162 bits (410),  Expect = 3e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> B0V6X7 30S ribosomal protein S17 [Acinetobacter baumannii (strain 
AYE)]
Length=85

 Score =  162 bits (410),  Expect = 3e-56
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAK+GD+V
Sbjct  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKIGDVV  60

Query  61  TIKESRPISKTKAWTLVEVVEVAAE  85
           TIKESRPISKTKAWTLVEVVE AAE
Sbjct  61  TIKESRPISKTKAWTLVEVVEAAAE  85


> A6UZJ7 30S ribosomal protein S17 [Pseudomonas aeruginosa (strain 
PA7)]
Length=88

 Score =  133 bits (335),  Expect = 6e-45
 Identities = 60/84 (71%), Positives = 78/84 (93%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           ++KTVRTLTG+VVSDKMDK++ VLIERRV+HP+YGK ++RSTKLHAHDE+N  ++GDLVT
Sbjct  4   AQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRSTKLHAHDESNQCRIGDLVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTKAWTLV++VE A E
Sbjct  64  IRETRPLAKTKAWTLVDIVERAVE  87


> B7V653 30S ribosomal protein S17 [Pseudomonas aeruginosa (strain 
LESB58)]
Length=88

 Score =  133 bits (335),  Expect = 6e-45
 Identities = 60/84 (71%), Positives = 78/84 (93%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           ++KTVRTLTG+VVSDKMDK++ VLIERRV+HP+YGK ++RSTKLHAHDE+N  ++GDLVT
Sbjct  4   AQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRSTKLHAHDESNQCRIGDLVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTKAWTLV++VE A E
Sbjct  64  IRETRPLAKTKAWTLVDIVERAVE  87


> Q02T71 30S ribosomal protein S17 [Pseudomonas aeruginosa (strain 
UCBPP-PA14)]
Length=88

 Score =  133 bits (335),  Expect = 6e-45
 Identities = 60/84 (71%), Positives = 78/84 (93%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           ++KTVRTLTG+VVSDKMDK++ VLIERRV+HP+YGK ++RSTKLHAHDE+N  ++GDLVT
Sbjct  4   AQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRSTKLHAHDESNQCRIGDLVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTKAWTLV++VE A E
Sbjct  64  IRETRPLAKTKAWTLVDIVERAVE  87


> Q9HWE4 30S ribosomal protein S17 [Pseudomonas aeruginosa (strain 
ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 
/ 1C / PRS 101 / PAO1)]
Length=88

 Score =  133 bits (335),  Expect = 6e-45
 Identities = 60/84 (71%), Positives = 78/84 (93%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           ++KTVRTLTG+VVSDKMDK++ VLIERRV+HP+YGK ++RSTKLHAHDE+N  ++GDLVT
Sbjct  4   AQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRSTKLHAHDESNQCRIGDLVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTKAWTLV++VE A E
Sbjct  64  IRETRPLAKTKAWTLVDIVERAVE  87


> Q1IFV7 30S ribosomal protein S17 [Pseudomonas entomophila (strain 
L48)]
Length=88

 Score =  129 bits (325),  Expect = 2e-43
 Identities = 60/84 (71%), Positives = 76/84 (90%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE+N  K+GD V+
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDESNQCKIGDKVS  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LVEV+E A E
Sbjct  64  IRETRPLAKTKSWALVEVLERAVE  87


> B0KK76 30S ribosomal protein S17 [Pseudomonas putida (strain 
GB-1)]
Length=88

 Score =  129 bits (325),  Expect = 2e-43
 Identities = 60/84 (71%), Positives = 76/84 (90%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE+N  K+GD V+
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDESNQCKIGDKVS  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LVEV+E A E
Sbjct  64  IRETRPLAKTKSWALVEVLERAVE  87


> B1JDX5 30S ribosomal protein S17 [Pseudomonas putida (strain 
W619)]
Length=88

 Score =  129 bits (325),  Expect = 2e-43
 Identities = 60/84 (71%), Positives = 76/84 (90%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE+N  K+GD V+
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDESNQCKIGDKVS  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LVEV+E A E
Sbjct  64  IRETRPLAKTKSWALVEVLERAVE  87


> C1DKM2 30S ribosomal protein S17 [Azotobacter vinelandii (strain 
DJ / ATCC BAA-1303)]
Length=88

 Score =  129 bits (325),  Expect = 2e-43
 Identities = 60/84 (71%), Positives = 75/84 (89%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           ++KTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N  ++GD VT
Sbjct  4   AQKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCRIGDTVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LVEVVE A E
Sbjct  64  IRETRPLAKTKSWMLVEVVERAVE  87


> A4XZ81 30S ribosomal protein S17 [Pseudomonas mendocina (strain 
ymp)]
Length=88

 Score =  129 bits (325),  Expect = 2e-43
 Identities = 62/83 (75%), Positives = 74/83 (89%), Gaps = 0/83 (0%)

Query  3   EKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVTI  62
           EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE+N  K+GD V+I
Sbjct  5   EKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDESNQCKIGDKVSI  64

Query  63  KESRPISKTKAWTLVEVVEVAAE  85
           +E+RP SKTK+W LVEVVE A E
Sbjct  65  RETRPQSKTKSWALVEVVERAVE  87


> A5VXQ6 30S ribosomal protein S17 [Pseudomonas putida (strain 
ATCC 700007 / DSM 6899 / BCRC 17059 / F1)]
Length=88

 Score =  128 bits (322),  Expect = 5e-43
 Identities = 60/84 (71%), Positives = 75/84 (89%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N  K+GD V+
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDEANQCKIGDKVS  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LVEV+E A E
Sbjct  64  IRETRPLAKTKSWALVEVLERAVE  87


> Q88QM6 30S ribosomal protein S17 [Pseudomonas putida (strain 
ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)]
Length=88

 Score =  128 bits (322),  Expect = 5e-43
 Identities = 60/84 (71%), Positives = 75/84 (89%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N  K+GD V+
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDEANQCKIGDKVS  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LVEV+E A E
Sbjct  64  IRETRPLAKTKSWALVEVLERAVE  87


> A4VHN9 30S ribosomal protein S17 [Pseudomonas stutzeri (strain 
A1501)]
Length=88

 Score =  128 bits (322),  Expect = 5e-43
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           ++KTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N  K+GD V+
Sbjct  4   AQKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCKIGDKVS  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP SKTK+W LVEVVE A E
Sbjct  64  IRETRPQSKTKSWALVEVVERAVE  87


> Q48D45 30S ribosomal protein S17 [Pseudomonas savastanoi pv. 
phaseolicola (strain 1448A / Race 6)]
Length=88

 Score =  127 bits (319),  Expect = 2e-42
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N   +GD VT
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCHIGDKVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LV+++E A E
Sbjct  64  IRETRPVAKTKSWALVDILERAVE  87


> Q889W2 30S ribosomal protein S17 [Pseudomonas syringae pv. tomato 
(strain ATCC BAA-871 / DC3000)]
Length=88

 Score =  127 bits (319),  Expect = 2e-42
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N   +GD VT
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCHIGDKVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LV+++E A E
Sbjct  64  IRETRPVAKTKSWALVDILERAVE  87


> Q4ZMQ3 30S ribosomal protein S17 [Pseudomonas syringae pv. syringae 
(strain B728a)]
Length=88

 Score =  127 bits (319),  Expect = 2e-42
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N   +GD VT
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCHIGDKVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LV+++E A E
Sbjct  64  IRETRPVAKTKSWALVDILERAVE  87


> C3K2W7 30S ribosomal protein S17 [Pseudomonas fluorescens (strain 
SBW25)]
Length=88

 Score =  127 bits (319),  Expect = 2e-42
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N   +GD VT
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCHIGDKVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LV+V+E A E
Sbjct  64  IRETRPLAKTKSWALVDVLERAVE  87


> Q4K542 30S ribosomal protein S17 [Pseudomonas fluorescens (strain 
ATCC BAA-477 / NRRL B-23932 / Pf-5)]
Length=88

 Score =  127 bits (318),  Expect = 2e-42
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N   +GD VT
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCHIGDKVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LV+V+E A E
Sbjct  64  IRETRPMAKTKSWALVDVLERAVE  87


> Q3K5Z7 30S ribosomal protein S17 [Pseudomonas fluorescens (strain 
Pf0-1)]
Length=88

 Score =  127 bits (318),  Expect = 2e-42
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)

Query  2   SEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVT  61
           +EKTVRTLTG+VVSDKMDK+I VLIERRV+HP+YGK ++RSTKLHAHDE N   +GD VT
Sbjct  4   AEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRSTKLHAHDETNQCHIGDKVT  63

Query  62  IKESRPISKTKAWTLVEVVEVAAE  85
           I+E+RP++KTK+W LV+V+E A E
Sbjct  64  IRETRPMAKTKSWALVDVLERAVE  87


> P55829 30S ribosomal protein S17 [Aggregatibacter actinomycetemcomitans]
Length=85

 Score =  120 bits (302),  Expect = 5e-40
 Identities = 59/83 (71%), Positives = 72/83 (87%), Gaps = 1/83 (1%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           M++K +R++ G+VVSDKM+KS VV IER+V+HPLYGK IRR+TKLH HDENN AKLGDLV
Sbjct  1   MTDK-IRSVQGRVVSDKMEKSFVVAIERKVKHPLYGKFIRRTTKLHVHDENNEAKLGDLV  59

Query  61  TIKESRPISKTKAWTLVEVVEVA  83
            ++E RPISKTK+WTLV VVE A
Sbjct  60  EVRECRPISKTKSWTLVRVVEKA  82


> P0AG63 30S ribosomal protein S17 [Escherichia coli (strain K12)]
Length=84

 Score =  114 bits (286),  Expect = 1e-37
 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 1/83 (1%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           M++K +RTL G+VVSDKM+KSIVV IER V+HP+YGK I+R+TKLH HDENN   +GD+V
Sbjct  1   MTDK-IRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVV  59

Query  61  TIKESRPISKTKAWTLVEVVEVA  83
            I+E RP+SKTK+WTLV VVE A
Sbjct  60  EIRECRPLSKTKSWTLVRVVEKA  82


> P46175 30S ribosomal protein S17 [Buchnera aphidicola subsp. 
Acyrthosiphon kondoi]
Length=84

 Score =  111 bits (277),  Expect = 3e-36
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)

Query  6   VRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVTIKES  65
           +RTL G+VVS KM+KSIVV IER V+HP+YGK I+R+TKLH HDENN   +GD+V I+E 
Sbjct  5   IRTLQGRVVSHKMEKSIVVAIERTVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIREC  64

Query  66  RPISKTKAWTLVEVVEVA  83
           RP+SKTK+WTLV VV+ A
Sbjct  65  RPLSKTKSWTLVRVVDKA  82


> P38519 30S ribosomal protein S17 [Thermotoga maritima (strain 
ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)]
Length=107

 Score = 99.0 bits (245),  Expect = 3e-31
 Identities = 43/75 (57%), Positives = 60/75 (80%), Gaps = 0/75 (0%)

Query  7   RTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVTIKESR  66
           + LTG VVSDKMDK++VV +E+ VQHPLY K ++R+ K HAHDE N  K+GD+V I+E+R
Sbjct  4   KRLTGIVVSDKMDKTVVVAVEKLVQHPLYKKYVKRTKKYHAHDERNECKIGDVVEIEETR  63

Query  67  PISKTKAWTLVEVVE  81
           P+SKTK W +V +++
Sbjct  64  PLSKTKRWRVVRIIQ  78


> P0A4B3 30S ribosomal protein S17 [Streptococcus pneumoniae serotype 
4 (strain ATCC BAA-334 / TIGR4)]
Length=86

 Score = 95.9 bits (237),  Expect = 3e-30
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 0/83 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           M     + L G+VVSDKMDK+I V++E +  HP+YGK I  S K  AHDENNVAK GD+V
Sbjct  1   MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKYKAHDENNVAKEGDIV  60

Query  61  TIKESRPISKTKAWTLVEVVEVA  83
            I E+RP+S TK + LVEVVE A
Sbjct  61  RIMETRPLSATKRFRLVEVVEEA  83


> P0A4B4 30S ribosomal protein S17 [Streptococcus pneumoniae (strain 
ATCC BAA-255 / R6)]
Length=86

 Score = 95.9 bits (237),  Expect = 3e-30
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 0/83 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           M     + L G+VVSDKMDK+I V++E +  HP+YGK I  S K  AHDENNVAK GD+V
Sbjct  1   MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKYKAHDENNVAKEGDIV  60

Query  61  TIKESRPISKTKAWTLVEVVEVA  83
            I E+RP+S TK + LVEVVE A
Sbjct  61  RIMETRPLSATKRFRLVEVVEEA  83


> P23828 30S ribosomal protein S17 [Geobacillus stearothermophilus]
Length=87

 Score = 94.4 bits (233),  Expect = 1e-29
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 1/84 (1%)

Query  1   MSEKTVRTL-TGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDL  59
           MSE+  R +  G+VVSDKMDK+I VL+E   +HPLYGK ++ S K  AHDE+N AK+GD+
Sbjct  1   MSERNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKVGDI  60

Query  60  VTIKESRPISKTKAWTLVEVVEVA  83
           V I E+RP+S TK + LVE+VE A
Sbjct  61  VKIMETRPLSATKRFRLVEIVEKA  84


> P12874 30S ribosomal protein S17 [Bacillus subtilis (strain 168)]
Length=87

 Score = 92.8 bits (229),  Expect = 5e-29
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 1/84 (1%)

Query  1   MSEKTVRTL-TGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDL  59
           MSE+  R +  G+VVSDKMDK+I V++E   +H LYGK ++ S K  AHDENN AK+GD+
Sbjct  1   MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKKFKAHDENNQAKIGDI  60

Query  60  VTIKESRPISKTKAWTLVEVVEVA  83
           V I E+RP+S TK + LVEVVE A
Sbjct  61  VKIMETRPLSATKRFRLVEVVEEA  84


> O06051 30S ribosomal protein S17 [Mycobacterium bovis (strain 
ATCC BAA-935 / AF2122/97)]
Length=135

 Score = 91.7 bits (226),  Expect = 4e-28
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)

Query  7    RTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVTIKESR  66
            +T  G VVSDKM K+IVV +E R++HPLYGK IR + K+ AHDE++VA +GD V++ E+R
Sbjct  58   KTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSVAGIGDRVSLMETR  117

Query  67   PISKTKAWTLVEVVEVA  83
            P+S TK W LVE++E A
Sbjct  118  PLSATKRWRLVEILEKA  134


> P0DOY7 30S ribosomal protein S17 [Thermus thermophilus (strain 
HB8 / ATCC 27634 / DSM 579)]
Length=105

 Score = 85.5 bits (210),  Expect = 5e-26
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)

Query  7   RTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVTIKESR  66
           + LTG VVSDKM K++ VL+ER+  HPLYGK I+RS K  AHD     KLGD+V I ESR
Sbjct  4   KVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESR  63

Query  67  PISKTKAWTLVEVVE  81
           PISK K + ++ +VE
Sbjct  64  PISKRKRFRVLRLVE  78


> P24321 30S ribosomal protein S17 [Thermus thermophilus]
Length=105

 Score = 85.5 bits (210),  Expect = 5e-26
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)

Query  7   RTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLVTIKESR  66
           + LTG VVSDKM K++ VL+ER+  HPLYGK I+RS K  AHD     KLGD+V I ESR
Sbjct  4   KVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESR  63

Query  67  PISKTKAWTLVEVVE  81
           PISK K + ++ +VE
Sbjct  64  PISKRKRFRVLRLVE  78


> O31164 30S ribosomal protein S17 [Spiroplasma citri]
Length=85

 Score = 82.8 bits (203),  Expect = 3e-25
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 0/83 (0%)

Query  1   MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVAKLGDLV  60
           M   + + L G+V+SD + K+I VL+E    HPLY K ++ S K  AHDE N A +GD V
Sbjct  1   MERNSRKVLQGRVISDNLKKTITVLVETYKNHPLYKKRVKYSKKYLAHDEQNQAHIGDKV  60

Query  61  TIKESRPISKTKAWTLVEVVEVA  83
           +I E+RP+SKTK + L+EV+E A
Sbjct  61  SIMETRPLSKTKHFRLIEVIEKA  83



Lambda      K        H        a         alpha
   0.321    0.132    0.364    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 120400


  Database: 2e83a3f7e36e30c43abde0c43090737f.SwissProt.fasta
    Posted date:  Sep 26, 2020  8:45 PM
  Number of letters in database: 3,230
  Number of sequences in database:  36



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40