ACIAD3211 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 7a92d331ad10e108e89461e90620b80f.TrEMBL.fasta
           30 sequences; 2,223 total letters



Query= ACIAD3211

Length=66
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  N9DIM2 50S ribosomal protein L29 [Acinetobacter ursingii ANC 3649]   123    1e-41
  A0A0B0KQP7 50S ribosomal protein L29 [Acinetobacter sp. neg1]        123    1e-41
  N8Q4W2 50S ribosomal protein L29 [Acinetobacter parvus NIPH 1103]    123    1e-41
  N9FHX8 50S ribosomal protein L29 [Acinetobacter haemolyticus NI...   123    1e-41
  A0A014DTK7 50S ribosomal protein L29 [Acinetobacter sp. 25977_3]     122    2e-41
  A0A140QUZ3 50S ribosomal protein L29 [Acinetobacter sp. 216872]      122    2e-41
  A0A010V235 50S ribosomal protein L29 [Acinetobacter sp. 263903-2]    122    2e-41
  N9DAK5 50S ribosomal protein L29 [Acinetobacter calcoaceticus A...   122    2e-41
  N9GW36 50S ribosomal protein L29 [Acinetobacter baumannii NIPH ...   122    2e-41
  N9BXT4 50S ribosomal protein L29 [Acinetobacter soli NIPH 2899]      122    2e-41
  A0A1P8EK01 50S ribosomal protein L29 [Acinetobacter soli]            122    2e-41
  A0A0M1I873 50S ribosomal protein L29 [Acinetobacter sp. C15]         122    2e-41
  S7Y327 50S ribosomal protein L29 [Acinetobacter junii MTCC 11364]    122    2e-41
  A0A2R4ULN7 50S ribosomal protein L29 [Acinetobacter junii]           122    2e-41
  A0A1F2VF20 50S ribosomal protein L29 [Acinetobacter sp. GWC1_38...   122    2e-41
  A0A1C3CSW5 50S ribosomal protein L29 [Acinetobacter celticus]        121    5e-41
  S3NQP2 50S ribosomal protein L29 [Acinetobacter rudis CIP 110305]    121    7e-41
  V2VWP3 50S ribosomal protein L29 [Acinetobacter brisouii CIP 11...   120    1e-40
  N8V8B5 50S ribosomal protein L29 [Acinetobacter sp. ANC 3789]        120    1e-40
  A0A2V1HIJ3 50S ribosomal protein L29 [Serratia sp. S1B]              120    1e-40
  N9N5V0 50S ribosomal protein L29 [Acinetobacter sp. ANC 3862]        120    1e-40
  N8QYB6 50S ribosomal protein L29 [Acinetobacter sp. NIPH 236]        120    1e-40
  A0A0M3AC23 50S ribosomal protein L29 [Acinetobacter sp. AG1]         120    1e-40
  A0A1Q3NBJ2 50S ribosomal protein L29 [Acinetobacter sp. 38-8]        120    1e-40
  N9KLU3 50S ribosomal protein L29 [Acinetobacter sp. NIPH 284]        120    1e-40
  Q86QR7 60S ribosomal protein L35 [Branchiostoma belcheri tsingt...  39.7    2e-09
  Q9W499 60S ribosomal protein L35 [Drosophila melanogaster]          38.9    4e-09
  K7NCV1 60S ribosomal protein L35 [Epichloe festucae var. lolii]     38.5    5e-09
  Q53U38 Similar to 60S ribosomal protein L35 [Solanum lycopersicum]  37.7    1e-08
  Q26035 15 kDa vesicular-like antigen [Plasmodium falciparum]        37.4    1e-08


> N9DIM2 50S ribosomal protein L29 [Acinetobacter ursingii ANC 
3649]
Length=65

 Score =  123 bits (308),  Expect = 1e-41
 Identities = 64/65 (98%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A0B0KQP7 50S ribosomal protein L29 [Acinetobacter sp. neg1]
Length=65

 Score =  123 bits (308),  Expect = 1e-41
 Identities = 64/65 (98%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N8Q4W2 50S ribosomal protein L29 [Acinetobacter parvus NIPH 1103]
Length=65

 Score =  123 bits (308),  Expect = 1e-41
 Identities = 64/65 (98%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N9FHX8 50S ribosomal protein L29 [Acinetobacter haemolyticus 
NIPH 261]
Length=65

 Score =  123 bits (308),  Expect = 1e-41
 Identities = 64/65 (98%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A014DTK7 50S ribosomal protein L29 [Acinetobacter sp. 25977_3]
Length=65

 Score =  122 bits (307),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A140QUZ3 50S ribosomal protein L29 [Acinetobacter sp. 216872]
Length=65

 Score =  122 bits (307),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A010V235 50S ribosomal protein L29 [Acinetobacter sp. 263903-2]
Length=65

 Score =  122 bits (307),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N9DAK5 50S ribosomal protein L29 [Acinetobacter calcoaceticus 
ANC 3680]
Length=65

 Score =  122 bits (307),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N9GW36 50S ribosomal protein L29 [Acinetobacter baumannii NIPH 
201]
Length=65

 Score =  122 bits (307),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N9BXT4 50S ribosomal protein L29 [Acinetobacter soli NIPH 2899]
Length=65

 Score =  122 bits (306),  Expect = 2e-41
 Identities = 62/65 (95%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKT+ARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTVARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A1P8EK01 50S ribosomal protein L29 [Acinetobacter soli]
Length=65

 Score =  122 bits (306),  Expect = 2e-41
 Identities = 62/65 (95%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKT+ARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTVARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A0M1I873 50S ribosomal protein L29 [Acinetobacter sp. C15]
Length=65

 Score =  122 bits (306),  Expect = 2e-41
 Identities = 62/65 (95%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARKT+ARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTVARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> S7Y327 50S ribosomal protein L29 [Acinetobacter junii MTCC 11364]
Length=65

 Score =  122 bits (306),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKA+LDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKAMLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A2R4ULN7 50S ribosomal protein L29 [Acinetobacter junii]
Length=65

 Score =  122 bits (306),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKA+LDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKAMLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A1F2VF20 50S ribosomal protein L29 [Acinetobacter sp. GWC1_38_13]
Length=65

 Score =  122 bits (306),  Expect = 2e-41
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKA+LDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKAMLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A1C3CSW5 50S ribosomal protein L29 [Acinetobacter celticus]
Length=65

 Score =  121 bits (304),  Expect = 5e-41
 Identities = 62/65 (95%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEV + RKTIARIKTLLTEK
Sbjct  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVAVTRKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> S3NQP2 50S ribosomal protein L29 [Acinetobacter rudis CIP 110305]
Length=65

 Score =  121 bits (303),  Expect = 7e-41
 Identities = 62/65 (95%), Positives = 64/65 (98%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARK+IARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKSIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> V2VWP3 50S ribosomal protein L29 [Acinetobacter brisouii CIP 
110357]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 62/65 (95%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARK IARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKAIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N8V8B5 50S ribosomal protein L29 [Acinetobacter sp. ANC 3789]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 62/65 (95%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARK IARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKAIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A2V1HIJ3 50S ribosomal protein L29 [Serratia sp. S1B]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 62/65 (95%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MKT DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQ+ARK IARIKTLLTEK
Sbjct  1   MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKAIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N9N5V0 50S ribosomal protein L29 [Acinetobacter sp. ANC 3862]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 63/65 (97%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MK  DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKIKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N8QYB6 50S ribosomal protein L29 [Acinetobacter sp. NIPH 236]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 63/65 (97%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MK  DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKIKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A0M3AC23 50S ribosomal protein L29 [Acinetobacter sp. AG1]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 63/65 (97%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MK  DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKIKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> A0A1Q3NBJ2 50S ribosomal protein L29 [Acinetobacter sp. 38-8]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 63/65 (97%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MK  DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKIKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> N9KLU3 50S ribosomal protein L29 [Acinetobacter sp. NIPH 284]
Length=65

 Score =  120 bits (302),  Expect = 1e-40
 Identities = 63/65 (97%), Positives = 63/65 (97%), Gaps = 0/65 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           MK  DLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK
Sbjct  1   MKIKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60

Query  61  QGNGQ  65
           QGNGQ
Sbjct  61  QGNGQ  65


> Q86QR7 60S ribosomal protein L35 [Branchiostoma belcheri tsingtauense]
Length=123

 Score = 39.7 bits (91),  Expect = 2e-09
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 1/62 (2%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKAT-GQLGKSHEVQIARKTIARIKTLLTE  59
           +K  +LR K  EEL   L E +    +LR+AK T G   K  +++I RK+IAR+ T++ +
Sbjct  4   IKAHELRGKKKEELLKQLSELKEELSQLRVAKVTGGAASKLSKIRIVRKSIARVMTVIHQ  63

Query  60  KQ  61
            Q
Sbjct  64  TQ  65


> Q9W499 60S ribosomal protein L35 [Drosophila melanogaster]
Length=123

 Score = 38.9 bits (89),  Expect = 4e-09
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQL-GKSHEVQIARKTIARIKTLLTE  59
           +K  +LR K  +EL   LDE +     LR+AK TG    K  ++++ RK IAR+  ++ +
Sbjct  4   VKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQ  63

Query  60  KQ  61
           KQ
Sbjct  64  KQ  65


 Score = 20.0 bits (40),  Expect = 0.040
 Identities = 8/28 (29%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  2    KTIDLREKSVEELKALLDEQQLNQFRLR  29
            K +DLR+K    ++  L  +  N+  L+
Sbjct  79   KPLDLRKKKTRAIRKALSPRDANRKTLK  106


> K7NCV1 60S ribosomal protein L35 [Epichloe festucae var. lolii]
Length=124

 Score = 38.5 bits (88),  Expect = 5e-09
 Identities = 20/61 (33%), Positives = 35/61 (57%), Gaps = 0/61 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           +KT+ L +KS ++L   L E +    +LR+ K      K +++   RK+IAR+ T++  K
Sbjct  6   VKTVQLWDKSKDDLTKQLGELKTELGQLRIQKVVSSSSKLNKIHDLRKSIARVLTVINAK  65

Query  61  Q  61
           Q
Sbjct  66  Q  66


> Q53U38 Similar to 60S ribosomal protein L35 [Solanum lycopersicum]
Length=123

 Score = 37.7 bits (86),  Expect = 1e-08
 Identities = 22/62 (35%), Positives = 38/62 (61%), Gaps = 1/62 (2%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQL-GKSHEVQIARKTIARIKTLLTE  59
           +K  +LR KS  EL A L + +     LR+AK TG    K  ++++ R +IA++ T++++
Sbjct  4   IKVHELRNKSKTELLAQLKDLKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQ  63

Query  60  KQ  61
           KQ
Sbjct  64  KQ  65


> Q26035 15 kDa vesicular-like antigen [Plasmodium falciparum]
Length=105

 Score = 37.4 bits (85),  Expect = 1e-08
 Identities = 20/61 (33%), Positives = 34/61 (56%), Gaps = 0/61 (0%)

Query  1   MKTIDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQIARKTIARIKTLLTEK  60
           +K  +LR    +EL   LDE +     LR++KA G   K+ ++   RK +AR+ T+  +K
Sbjct  4   VKAYELRTLKKKELLDKLDELKKELSGLRISKALGNSAKNSKIHGVRKNVARVLTVYNQK  63

Query  61  Q  61
           +
Sbjct  64  R  64



Lambda      K        H        a         alpha
   0.324    0.136    0.355    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 60393


  Database: 7a92d331ad10e108e89461e90620b80f.TrEMBL.fasta
    Posted date:  Sep 26, 2020  8:02 PM
  Number of letters in database: 2,223
  Number of sequences in database:  30



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40