ACIAD3217 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f705294f78e3f3f943548dd61eec16ff.TrEMBL.fasta
           32 sequences; 3,628 total letters



Query= ACIAD3217

Length=107
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A0M1I896 50S ribosomal protein L23 [Acinetobacter sp. C15]         204    3e-72
  A0A1P8EJZ3 50S ribosomal protein L23 [Acinetobacter soli]            204    3e-72
  N9AHM4 50S ribosomal protein L23 [Acinetobacter soli NIPH 2899]      204    3e-72
  A0A217EGG2 50S ribosomal protein L23 [Acinetobacter apis]            199    5e-70
  A0A009IPD8 50S ribosomal protein L23 [Acinetobacter baumannii (...   198    7e-70
  S3TI66 50S ribosomal protein L23 [Acinetobacter baumannii NIPH ...   198    7e-70
  D0CCZ9 50S ribosomal protein L23 [Acinetobacter baumannii (stra...   198    7e-70
  A0A009PKA8 50S ribosomal protein L23 [Acinetobacter baumannii 6...   198    7e-70
  K9AEK9 50S ribosomal protein L23 [Acinetobacter sp. WC-141]          197    1e-69
  A0A009ZUJ3 50S ribosomal protein L23 [Acinetobacter sp. 479375]      197    1e-69
  R8XYX6 50S ribosomal protein L23 [Acinetobacter calcoaceticus A...   197    1e-69
  A0A0A8XEI8 50S ribosomal protein L23 [Acinetobacter calcoaceticus]   197    1e-69
  D8JMY9 50S ribosomal protein L23 [Acinetobacter oleivorans (str...   197    1e-69
  A0A014F7G5 50S ribosomal protein L23 [Acinetobacter sp. 25977_10]    197    3e-69
  A0A009N2I7 50S ribosomal protein L23 [Acinetobacter sp. 1475718]     197    3e-69
  A0A014CJ64 50S ribosomal protein L23 [Acinetobacter sp. 25977_3]     197    3e-69
  A0A1Z9Z2Z7 50S ribosomal protein L23 [Acinetobacter populi]          196    4e-69
  A0A011JVM7 50S ribosomal protein L23 [Acinetobacter sp. 723929]      196    8e-69
  A0A009GI41 50S ribosomal protein L23 [Acinetobacter sp. 1289694]     195    1e-68
  A0A151YK38 50S ribosomal protein L23 [Acinetobacter lactucae]        195    2e-68
  V2TQG5 50S ribosomal protein L23 [Acinetobacter nectaris CIP 11...   194    3e-68
  E2RXT1 50S ribosomal protein L23 [Pseudomonas aeruginosa]           98.2    1e-30
  Q8GM58 50S ribosomal protein L23 [Mycoplasma hominis]               62.4    1e-16
  A2RNQ3 50S ribosomal protein L23 [Lactococcus lactis subsp. cre...  60.8    2e-16
  S5G966 Ribosomal protein L23a Y-linked protein [Bos taurus]         51.6    7e-13
  F2X266 Ribosomal protein L23A [Ailuropoda melanoleuca]              50.8    1e-12
  O81229 Ribosomal protein L25 [Zea mays]                             47.4    1e-11
  A1Y9U8 50S ribosomal protein L23 [Flavobacterium hibernum]          47.0    2e-11
  Q6Q416 Ribosomal protein L23a [Danio rerio]                         47.4    2e-11
  A5I8N9 Ribosomal protein L23 [Haemaphysalis qinghaiensis]           45.1    1e-10
  A5H1Q6 Ribosomal protein L23 [Haemaphysalis longicornis]            45.1    1e-10
  Q9XYW0 Ribosomal protein L23A [Entamoeba histolytica]               43.9    2e-10


> A0A0M1I896 50S ribosomal protein L23 [Acinetobacter sp. C15]
Length=106

 Score =  204 bits (520),  Expect = 3e-72
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A1P8EJZ3 50S ribosomal protein L23 [Acinetobacter soli]
Length=106

 Score =  204 bits (520),  Expect = 3e-72
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> N9AHM4 50S ribosomal protein L23 [Acinetobacter soli NIPH 2899]
Length=106

 Score =  204 bits (520),  Expect = 3e-72
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A217EGG2 50S ribosomal protein L23 [Acinetobacter apis]
Length=106

 Score =  199 bits (505),  Expect = 5e-70
 Identities = 101/106 (95%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQ+L+GPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVE+LFGVDV+KVNTT
Sbjct  1    MNNERIYQILRGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEQLFGVDVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAES AE
Sbjct  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESTAE  106


> A0A009IPD8 50S ribosomal protein L23 [Acinetobacter baumannii 
(strain 1295743)]
Length=106

 Score =  198 bits (504),  Expect = 7e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> S3TI66 50S ribosomal protein L23 [Acinetobacter baumannii NIPH 
410]
Length=106

 Score =  198 bits (504),  Expect = 7e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> D0CCZ9 50S ribosomal protein L23 [Acinetobacter baumannii (strain 
ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 
/ NCIMB 12457 / NCTC 12156 / 81)]
Length=106

 Score =  198 bits (504),  Expect = 7e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A009PKA8 50S ribosomal protein L23 [Acinetobacter baumannii 
625974]
Length=106

 Score =  198 bits (504),  Expect = 7e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> K9AEK9 50S ribosomal protein L23 [Acinetobacter sp. WC-141]
Length=106

 Score =  197 bits (502),  Expect = 1e-69
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLE+KKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEVKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A009ZUJ3 50S ribosomal protein L23 [Acinetobacter sp. 479375]
Length=106

 Score =  197 bits (502),  Expect = 1e-69
 Identities = 100/106 (94%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLE+KKAVE+LFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEVKKAVEQLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> R8XYX6 50S ribosomal protein L23 [Acinetobacter calcoaceticus 
ANC 3811]
Length=106

 Score =  197 bits (502),  Expect = 1e-69
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLE+KKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEVKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A0A8XEI8 50S ribosomal protein L23 [Acinetobacter calcoaceticus]
Length=106

 Score =  197 bits (502),  Expect = 1e-69
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLE+KKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEVKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> D8JMY9 50S ribosomal protein L23 [Acinetobacter oleivorans (strain 
JCM 16667 / KCTC 23045 / DR1)]
Length=106

 Score =  197 bits (502),  Expect = 1e-69
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLE+KKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEVKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A014F7G5 50S ribosomal protein L23 [Acinetobacter sp. 25977_10]
Length=106

 Score =  197 bits (500),  Expect = 3e-69
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A009N2I7 50S ribosomal protein L23 [Acinetobacter sp. 1475718]
Length=106

 Score =  197 bits (500),  Expect = 3e-69
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A014CJ64 50S ribosomal protein L23 [Acinetobacter sp. 25977_3]
Length=106

 Score =  197 bits (500),  Expect = 3e-69
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A1Z9Z2Z7 50S ribosomal protein L23 [Acinetobacter populi]
Length=106

 Score =  196 bits (499),  Expect = 4e-69
 Identities = 99/106 (93%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQ+LKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQILKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAE+ AE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAETTAE  106


> A0A011JVM7 50S ribosomal protein L23 [Acinetobacter sp. 723929]
Length=106

 Score =  196 bits (497),  Expect = 8e-69
 Identities = 99/106 (93%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLEIKKAVE+LFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEIKKAVERLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A009GI41 50S ribosomal protein L23 [Acinetobacter sp. 1289694]
Length=106

 Score =  195 bits (496),  Expect = 1e-68
 Identities = 99/106 (93%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+T GVQVFKVDINATKLEIKKAVE+LFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEIKKAVEELFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A0A151YK38 50S ribosomal protein L23 [Acinetobacter lactucae]
Length=106

 Score =  195 bits (495),  Expect = 2e-68
 Identities = 99/106 (93%), Positives = 104/106 (98%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIY VLKGPVFSEKAQVLG+T GVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYHVLKGPVFSEKAQVLGDTVGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> V2TQG5 50S ribosomal protein L23 [Acinetobacter nectaris CIP 
110549]
Length=106

 Score =  194 bits (493),  Expect = 3e-68
 Identities = 97/106 (92%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVL+GPVFSEKAQVLGETAGVQVFKVD+NATKLE+KKAVE+LFGV+V+KVNTT
Sbjct  1    MNNERIYQVLRGPVFSEKAQVLGETAGVQVFKVDLNATKLEVKKAVEQLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAE+ AE
Sbjct  61   ITKGKTKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAENTAE  106


> E2RXT1 50S ribosomal protein L23 [Pseudomonas aeruginosa]
Length=99

 Score = 98.2 bits (243),  Expect = 1e-30
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 0/95 (0%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           MN ER+++VL GP  SEKA  L +     VFKV  +ATKLEIKKAVE LF V V +V T 
Sbjct  1   MNQERVFKVLLGPHISEKATGLADGKSQFVFKVATDATKLEIKKAVESLFSVKVQRVTTL  60

Query  61  ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMA  95
             KGK+KR  + LG+R+D KKAY+ L+ GQD++ A
Sbjct  61  NVKGKTKRTARGLGKRNDWKKAYIALQPGQDLDFA  95


> Q8GM58 50S ribosomal protein L23 [Mycoplasma hominis]
Length=143

 Score = 62.4 bits (150),  Expect = 1e-16
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 0/81 (0%)

Query  6   IYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGK  65
           I +V+K P+ +EK+++  E   V  F VD    K+E+KKAVE +F V VLKVN T    K
Sbjct  3   INEVIKYPLLTEKSELSRENKNVYTFVVDKRTNKIEVKKAVEFIFDVKVLKVNITNYDKK  62

Query  66  SKRFGKTLGRRSDVKKAYVTL  86
             + G+  G ++ VKKA V L
Sbjct  63  PAKLGRFSGFKNSVKKATVYL  83


> A2RNQ3 50S ribosomal protein L23 [Lactococcus lactis subsp. cremoris 
(strain MG1363)]
Length=97

 Score = 60.8 bits (146),  Expect = 2e-16
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query  6   IYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGK  65
           +Y +++ P+ +E A +         F+VD  A KL IK+AVE +F V V  VNT   K K
Sbjct  3   LYDIIRKPIITE-ASMAAMDQKKYTFEVDSRAHKLLIKQAVEAVFDVKVASVNTISVKPK  61

Query  66  SKRFGKTLGRRSDVKKAYVTL  86
           SKR GK  G +S  KKA VTL
Sbjct  62  SKRVGKYTGTKSGYKKAIVTL  82


> S5G966 Ribosomal protein L23a Y-linked protein [Bos taurus]
Length=158

 Score = 51.6 bits (122),  Expect = 7e-13
 Identities = 33/85 (39%), Positives = 43/85 (51%), Gaps = 13/85 (15%)

Query  7    YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
            Y ++K P+ +E A    E     VF VD+ A K +IK+AV+KL+ +DV KVNT I     
Sbjct  76   YAIIKFPLTTESAMKKIEDNNTLVFTVDVKANKHQIKQAVKKLYDIDVAKVNTLI-----  130

Query  67   KRFGKTLGRRSDVKKAYVTLKAGQD  91
                    R    KKAYV L    D
Sbjct  131  --------RPDGEKKAYVRLAPDYD  147


> F2X266 Ribosomal protein L23A [Ailuropoda melanoleuca]
Length=156

 Score = 50.8 bits (120),  Expect = 1e-12
 Identities = 33/85 (39%), Positives = 43/85 (51%), Gaps = 13/85 (15%)

Query  7    YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
            Y ++K P+ +E A    E     VF VD+ A K +IK+AV+KL+ +DV KVNT I     
Sbjct  74   YAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLI-----  128

Query  67   KRFGKTLGRRSDVKKAYVTLKAGQD  91
                    R    KKAYV L    D
Sbjct  129  --------RPDGEKKAYVRLAPDYD  145


> O81229 Ribosomal protein L25 [Zea mays]
Length=109

 Score = 47.4 bits (111),  Expect = 1e-11
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 1/66 (2%)

Query  7   YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTI-TKGK  65
           YQ+LK P+ +E A    E     VF VD+ A K +IK AV+K++ +   KVNT I   GK
Sbjct  27  YQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGK  86

Query  66  SKRFGK  71
            K + K
Sbjct  87  KKAYVK  92


> A1Y9U8 50S ribosomal protein L23 [Flavobacterium hibernum]
Length=96

 Score = 47.0 bits (110),  Expect = 2e-11
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 4/85 (5%)

Query  13  PVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITK----GKSKR  68
           P+ +EK     E      F VD  A K++IKKAVE  +GV ++ VNT   +     K  +
Sbjct  7   PIVTEKVTKESEVLNRFGFVVDKKANKVQIKKAVEAAYGVTIVSVNTMNVRPDRTTKYTK  66

Query  69  FGKTLGRRSDVKKAYVTLKAGQDVE  93
            G   G+ + +KKA V ++ G+ ++
Sbjct  67  SGLISGKTNAIKKAIVQVQEGETID  91


> Q6Q416 Ribosomal protein L23a [Danio rerio]
Length=155

 Score = 47.4 bits (111),  Expect = 2e-11
 Identities = 32/85 (38%), Positives = 41/85 (48%), Gaps = 13/85 (15%)

Query  7    YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
            Y ++K P+ +E A    E     VF VD+ A K +IK AV+K + +DV KVNT I     
Sbjct  73   YAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKPYDIDVAKVNTLI-----  127

Query  67   KRFGKTLGRRSDVKKAYVTLKAGQD  91
                    R    KKAYV L    D
Sbjct  128  --------RPDGEKKAYVRLAPDYD  144


> A5I8N9 Ribosomal protein L23 [Haemaphysalis qinghaiensis]
Length=135

 Score = 45.1 bits (105),  Expect = 1e-10
 Identities = 30/85 (35%), Positives = 40/85 (47%), Gaps = 13/85 (15%)

Query  7    YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
            + ++K P+ +E A    E     VF V + A K +IK AV+KL+ +DV  VNT I     
Sbjct  53   FSIIKNPLTTESAMKKIEDNNTLVFIVHLRANKHQIKTAVKKLYDIDVANVNTLI-----  107

Query  67   KRFGKTLGRRSDVKKAYVTLKAGQD  91
                    R    KKAYV L    D
Sbjct  108  --------RPDGQKKAYVRLAPDYD  124


> A5H1Q6 Ribosomal protein L23 [Haemaphysalis longicornis]
Length=135

 Score = 45.1 bits (105),  Expect = 1e-10
 Identities = 30/85 (35%), Positives = 40/85 (47%), Gaps = 13/85 (15%)

Query  7    YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
            + ++K P+ +E A    E     VF V + A K +IK AV+KL+ +DV  VNT I     
Sbjct  53   FSIIKNPLTTESAMKKIEDNNTLVFIVHLRANKHQIKTAVKKLYDIDVANVNTLI-----  107

Query  67   KRFGKTLGRRSDVKKAYVTLKAGQD  91
                    R    KKAYV L    D
Sbjct  108  --------RPDGQKKAYVRLAPDYD  124


> Q9XYW0 Ribosomal protein L23A [Entamoeba histolytica]
Length=119

 Score = 43.9 bits (102),  Expect = 2e-10
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 15/91 (16%)

Query  7    YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
            + ++K P+ +E A    E     VF  +  A K  IKKAVEK +GV V+KVNT +     
Sbjct  37   FSIIKFPLATETALKKIEDHNTLVFLCEQKANKTMIKKAVEKRYGVKVIKVNTLV-----  91

Query  67   KRFGKTLGRRSDVKKAYVTLKAGQDVEMADL  97
                    R   +KKA+V L    DVE  ++
Sbjct  92   --------RLDGLKKAFVRL--APDVEAMEV  112



Lambda      K        H        a         alpha
   0.318    0.134    0.358    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 190328


  Database: f705294f78e3f3f943548dd61eec16ff.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:51 PM
  Number of letters in database: 3,628
  Number of sequences in database:  32



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40