ACIAD3217 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: e4759b76e54e01068776adffffef875b.SwissProt.fasta
           27 sequences; 2,838 total letters



Query= ACIAD3217

Length=107
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F7R4 50S ribosomal protein L23 [Acinetobacter baylyi (strain ...   204    2e-72
  B7GW04 50S ribosomal protein L23 [Acinetobacter baumannii (stra...   198    6e-70
  B7IA37 50S ribosomal protein L23 [Acinetobacter baumannii (stra...   198    6e-70
  B2HZM0 50S ribosomal protein L23 [Acinetobacter baumannii (stra...   198    6e-70
  A3M981 50S ribosomal protein L23 [Acinetobacter baumannii (stra...   198    6e-70
  B0V6X0 50S ribosomal protein L23 [Acinetobacter baumannii (stra...   198    6e-70
  B0VQS0 50S ribosomal protein L23 [Acinetobacter baumannii (stra...   194    2e-68
  A5WCJ2 50S ribosomal protein L23 [Psychrobacter sp. (strain PRw...   149    2e-50
  Q4FUF4 50S ribosomal protein L23 [Psychrobacter arcticus (strai...   148    3e-50
  Q1QDI4 50S ribosomal protein L23 [Psychrobacter cryohalolentis ...   148    3e-50
  Q9JX11 50S ribosomal protein L23 [Neisseria meningitidis serogr...   112    5e-36
  Q5E8B3 50S ribosomal protein L23 [Aliivibrio fischeri (strain A...   110    2e-35
  B5FG11 50S ribosomal protein L23 [Aliivibrio fischeri (strain M...   110    2e-35
  A1KRH5 50S ribosomal protein L23 [Neisseria meningitidis serogr...   110    3e-35
  Q9K1I6 50S ribosomal protein L23 [Neisseria meningitidis serogr...   108    1e-34
  B6EPS7 50S ribosomal protein L23 [Aliivibrio salmonicida (strai...   106    5e-34
  P0C2N0 50S ribosomal protein L23 [Yersinia enterocolitica]          93.6    6e-29
  P69964 50S ribosomal protein L23 [Yersinia pseudotuberculosis s...  93.6    6e-29
  P0ADZ0 50S ribosomal protein L23 [Escherichia coli (strain K12)]    92.8    1e-28
  P55839 50S ribosomal protein L23 [Aggregatibacter actinomycetem...  92.0    2e-28
  Q9RA57 50S ribosomal protein L23 [Thermus thermophilus]             74.7    1e-21
  Q9RXK0 50S ribosomal protein L23 [Deinococcus radiodurans (stra...  72.8    5e-21
  Q9ZI48 50S ribosomal protein L23 [Aquifex pyrophilus]               63.5    2e-17
  P42924 50S ribosomal protein L23 [Bacillus subtilis (strain 168)]   62.8    3e-17
  P04454 50S ribosomal protein L23 [Geobacillus stearothermophilus]   59.7    4e-16
  P38512 50S ribosomal protein L23 [Thermotoga maritima (strain A...  58.2    2e-15
  P04456 60S ribosomal protein L25 [Saccharomyces cerevisiae (str...  58.5    2e-15


> Q6F7R4 50S ribosomal protein L23 [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=106

 Score =  204 bits (520),  Expect = 2e-72
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> B7GW04 50S ribosomal protein L23 [Acinetobacter baumannii (strain 
AB307-0294)]
Length=106

 Score =  198 bits (504),  Expect = 6e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> B7IA37 50S ribosomal protein L23 [Acinetobacter baumannii (strain 
AB0057)]
Length=106

 Score =  198 bits (504),  Expect = 6e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> B2HZM0 50S ribosomal protein L23 [Acinetobacter baumannii (strain 
ACICU)]
Length=106

 Score =  198 bits (504),  Expect = 6e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A3M981 50S ribosomal protein L23 [Acinetobacter baumannii (strain 
ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)]
Length=106

 Score =  198 bits (504),  Expect = 6e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> B0V6X0 50S ribosomal protein L23 [Acinetobacter baumannii (strain 
AYE)]
Length=106

 Score =  198 bits (504),  Expect = 6e-70
 Identities = 101/106 (95%), Positives = 106/106 (100%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKGPVFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> B0VQS0 50S ribosomal protein L23 [Acinetobacter baumannii (strain 
SDF)]
Length=106

 Score =  194 bits (494),  Expect = 2e-68
 Identities = 100/106 (94%), Positives = 105/106 (99%), Gaps = 0/106 (0%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MNNERIYQVLKG VFSEKAQVLG+TAGVQVFKVDINATKLEIKKAVEKLFGV+V+KVNTT
Sbjct  1    MNNERIYQVLKGLVFSEKAQVLGDTAGVQVFKVDINATKLEIKKAVEKLFGVEVVKVNTT  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            ITKGK+KRFG+TLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE
Sbjct  61   ITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106


> A5WCJ2 50S ribosomal protein L23 [Psychrobacter sp. (strain PRwf-1)]
Length=116

 Score =  149 bits (375),  Expect = 2e-50
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 2/107 (2%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLF-GVDVLKVNT  59
            MNN R+YQVLKGPVFSEK+Q+LG++ GVQVFKVD NATK EIKKAVE +F GV+V KVNT
Sbjct  1    MNNARLYQVLKGPVFSEKSQLLGDSLGVQVFKVDNNATKREIKKAVELMFEGVEVTKVNT  60

Query  60   TITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLG-DTAESAA  105
               KGK+KRFG+T+GRR+D KKAYVTLKAGQDV+MAD G + A++AA
Sbjct  61   LNVKGKTKRFGRTVGRRNDYKKAYVTLKAGQDVQMADAGEEIADNAA  107


> Q4FUF4 50S ribosomal protein L23 [Psychrobacter arcticus (strain 
DSM 17307 / VKM B-2377 / 273-4)]
Length=116

 Score =  148 bits (374),  Expect = 3e-50
 Identities = 72/100 (72%), Positives = 89/100 (89%), Gaps = 1/100 (1%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLF-GVDVLKVNT  59
           MNN R+YQ+L+GPVFSEK+Q+LG++ GVQVFK+D  ATKLE+KKAVE +F GV+VLKVNT
Sbjct  1   MNNARLYQILRGPVFSEKSQMLGDSLGVQVFKIDSKATKLEVKKAVEMMFEGVEVLKVNT  60

Query  60  TITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGD  99
              KGK+KRFGK++GRR+D KKAYVTLKAGQDV+MAD G+
Sbjct  61  LNVKGKTKRFGKSIGRRNDYKKAYVTLKAGQDVQMADAGE  100


> Q1QDI4 50S ribosomal protein L23 [Psychrobacter cryohalolentis 
(strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)]
Length=116

 Score =  148 bits (374),  Expect = 3e-50
 Identities = 72/100 (72%), Positives = 89/100 (89%), Gaps = 1/100 (1%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLF-GVDVLKVNT  59
           MNN R+YQ+L+GPVFSEK+Q+LG++ GVQVFK+D  ATKLE+KKAVE +F GV+VLKVNT
Sbjct  1   MNNARLYQILRGPVFSEKSQMLGDSLGVQVFKIDSKATKLEVKKAVEMMFEGVEVLKVNT  60

Query  60  TITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGD  99
              KGK+KRFGK++GRR+D KKAYVTLKAGQDV+MAD G+
Sbjct  61  LNVKGKTKRFGKSIGRRNDYKKAYVTLKAGQDVQMADAGE  100


> Q9JX11 50S ribosomal protein L23 [Neisseria meningitidis serogroup 
A / serotype 4A (strain Z2491)]
Length=106

 Score =  112 bits (279),  Expect = 5e-36
 Identities = 60/106 (57%), Positives = 75/106 (71%), Gaps = 4/106 (4%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MN +R+ QV+  P+ SEK+ VL E      FKV  NATK EIK AVE LFGV V  V T 
Sbjct  3    MNQQRLTQVILAPIVSEKSNVLAEKRNQMTFKVLANATKPEIKAAVELLFGVQVASVTTV  62

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
             TKGK+KRFG+TLGRRSDVKKAYV+L AGQ++++    + A +AA+
Sbjct  63   TTKGKTKRFGRTLGRRSDVKKAYVSLAAGQELDL----EAAAAAAD  104


> Q5E8B3 50S ribosomal protein L23 [Aliivibrio fischeri (strain 
ATCC 700601 / ES114)]
Length=100

 Score =  110 bits (274),  Expect = 2e-35
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 0/93 (0%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           +N ER+ +VL+GP+ SEKA +  E     VFKV INATK EIK AVEKLF V+V  VNT 
Sbjct  2   INEERLLKVLRGPLISEKATMAAEGNNTIVFKVAINATKKEIKAAVEKLFEVEVKSVNTL  61

Query  61  ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           ITKGK+KR G   GRRSDVKKAYV LK GQD++
Sbjct  62  ITKGKTKRQGLRQGRRSDVKKAYVILKEGQDLD  94


> B5FG11 50S ribosomal protein L23 [Aliivibrio fischeri (strain 
MJ11)]
Length=100

 Score =  110 bits (274),  Expect = 2e-35
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 0/93 (0%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           +N ER+ +VL+GP+ SEKA +  E     VFKV INATK EIK AVEKLF V+V  VNT 
Sbjct  2   INEERLLKVLRGPLISEKATMAAEGNNTIVFKVAINATKKEIKAAVEKLFEVEVKSVNTL  61

Query  61  ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           ITKGK+KR G   GRRSDVKKAYV LK GQD++
Sbjct  62  ITKGKTKRQGLRQGRRSDVKKAYVILKEGQDLD  94


> A1KRH5 50S ribosomal protein L23 [Neisseria meningitidis serogroup 
C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)]
Length=106

 Score =  110 bits (274),  Expect = 3e-35
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 4/106 (4%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MN +R+ QV+  P+ SEK+ VL E      FKV  NA K EIK AVE LFGV V  V T 
Sbjct  3    MNQQRLTQVILAPIVSEKSNVLAEKRNQMTFKVLANAAKPEIKAAVELLFGVQVASVTTV  62

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
             TKGK+KRFG+TLGRRSDVKKAYV+L AGQ++++    + A +AA+
Sbjct  63   TTKGKTKRFGRTLGRRSDVKKAYVSLAAGQELDL----EAAAAAAD  104


> Q9K1I6 50S ribosomal protein L23 [Neisseria meningitidis serogroup 
B (strain MC58)]
Length=104

 Score =  108 bits (269),  Expect = 1e-34
 Identities = 59/106 (56%), Positives = 73/106 (69%), Gaps = 4/106 (4%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            MN +R+ QV+  P+ SEK+ VL E      FKV  NATK EIK AVE LFGV V  V T 
Sbjct  1    MNQQRLTQVILAPIVSEKSNVLAEKRNQMTFKVLANATKPEIKAAVELLFGVQVADVTTV  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
              KGK KRFG+TLGRRSDVKKAYV+L AGQ++++    + A +AA+
Sbjct  61   TIKGKVKRFGRTLGRRSDVKKAYVSLAAGQELDL----EAAAAAAD  102


> B6EPS7 50S ribosomal protein L23 [Aliivibrio salmonicida (strain 
LFI1238)]
Length=100

 Score =  106 bits (265),  Expect = 5e-34
 Identities = 58/93 (62%), Positives = 68/93 (73%), Gaps = 0/93 (0%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           ++ ER+ +VL+GP  SEKA +  E     VFKV INATK EIK AVEKLF V+V  VNT 
Sbjct  2   ISEERLLKVLRGPHISEKATMTAEGNNTIVFKVVINATKKEIKAAVEKLFEVEVKSVNTL  61

Query  61  ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           ITKGK+KR G   GRRSDVKKAYV LK GQD++
Sbjct  62  ITKGKTKRQGARQGRRSDVKKAYVILKEGQDLD  94


> P0C2N0 50S ribosomal protein L23 [Yersinia enterocolitica]
Length=100

 Score = 93.6 bits (231),  Expect = 6e-29
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 0/93 (0%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           +  ER+ +VL+ P  SEKA    E     V KV  +ATK EIK AV+KLF V+V  VNT 
Sbjct  2   IREERLLKVLRAPHVSEKASAAMEKNNTIVLKVAKDATKAEIKAAVQKLFEVEVEDVNTL  61

Query  61  ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           + KGKSKR G+ +GRRSD KKAYVTLK GQ+++
Sbjct  62  LVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLD  94


> P69964 50S ribosomal protein L23 [Yersinia pseudotuberculosis 
serotype I (strain IP32953)]
Length=100

 Score = 93.6 bits (231),  Expect = 6e-29
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 0/93 (0%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           +  ER+ +VL+ P  SEKA    E     V KV  +ATK EIK AV+KLF V+V  VNT 
Sbjct  2   IREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKAAVQKLFEVEVEDVNTL  61

Query  61  ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           + KGKSKR G+ +GRRSD KKAYVTLK GQ+++
Sbjct  62  LVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLD  94


> P0ADZ0 50S ribosomal protein L23 [Escherichia coli (strain K12)]
Length=100

 Score = 92.8 bits (229),  Expect = 1e-28
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 0/93 (0%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           +  ER+ +VL+ P  SEKA    E +   V KV  +ATK EIK AV+KLF V+V  VNT 
Sbjct  2   IREERLLKVLRAPHVSEKASTAMEKSNTIVLKVAKDATKAEIKAAVQKLFEVEVEVVNTL  61

Query  61  ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           + KGK KR G+ +GRRSD KKAYVTLK GQ+++
Sbjct  62  VVKGKVKRHGQRIGRRSDWKKAYVTLKEGQNLD  94


> P55839 50S ribosomal protein L23 [Aggregatibacter actinomycetemcomitans]
Length=100

 Score = 92.0 bits (227),  Expect = 2e-28
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 6/106 (6%)

Query  1    MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
            M+ ER+ +VLK P  SEKA    E +   VFKV ++A K+EI  AVE+LF V V  V T 
Sbjct  1    MSQERLLKVLKAPHISEKATNNAEKSNTIVFKVALDANKVEITNAVEQLFEVKVDSVRTV  60

Query  61   ITKGKSKRFGKTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESAAE  106
            + KGK+KR G  +GRRSD KKAYVTL+ GQ +      D  E AAE
Sbjct  61   VVKGKTKRRGAKIGRRSDWKKAYVTLQEGQSL------DFVEGAAE  100


> Q9RA57 50S ribosomal protein L23 [Thermus thermophilus]
Length=96

 Score = 74.7 bits (182),  Expect = 1e-21
 Identities = 44/87 (51%), Positives = 51/87 (59%), Gaps = 1/87 (1%)

Query  7   YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
           Y V+  PV SEKA   G   G   F V   ATK EIK AVE  F V V+KVNT   +GK 
Sbjct  5   YDVILAPVLSEKAYA-GFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKK  63

Query  67  KRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           KR G+ LG+R D KKA V +  GQ +E
Sbjct  64  KRLGRYLGKRPDRKKAIVQVAPGQKIE  90


> Q9RXK0 50S ribosomal protein L23 [Deinococcus radiodurans (strain 
ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 
/ NCIMB 9279 / R1 / VKM B-1422)]
Length=95

 Score = 72.8 bits (177),  Expect = 5e-21
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query  7   YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
           Y +L+ PV SEKA    E  GV  F V   ATK EIK A+++ FGV V+ ++T    GK 
Sbjct  4   YDILQAPVISEKAYSAMER-GVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKR  62

Query  67  KRFGKTLGRRSDVKKAYVTLKAGQDVE  93
           KR G+ +G+R+D KKA V L  GQ +E
Sbjct  63  KRVGRFIGQRNDRKKAIVRLAEGQSIE  89


> Q9ZI48 50S ribosomal protein L23 [Aquifex pyrophilus]
Length=109

 Score = 63.5 bits (153),  Expect = 2e-17
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 3/92 (3%)

Query  1   MNNERIYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTT  60
           M+  + +++L  P+ +EK+  L E      F+V ++A+K EIK+AVEKLF V V KVNT 
Sbjct  1   MSQRKPWEILIRPIITEKSNRLMEDYNKYTFEVALDASKPEIKEAVEKLFNVKVKKVNTM  60

Query  61  ITKGKSKRFG---KTLGRRSDVKKAYVTLKAG  89
           I K K KR     +  G     KKA VTL+ G
Sbjct  61  IVKPKKKRVWERFRQYGTTKKWKKAIVTLEKG  92


> P42924 50S ribosomal protein L23 [Bacillus subtilis (strain 168)]
Length=95

 Score = 62.8 bits (151),  Expect = 3e-17
 Identities = 39/80 (49%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query  9   VLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKSKR  68
           VLK PV +E++  L  T     F+VD+ A K E+K AVE +FGV V KVN    KGKSKR
Sbjct  7   VLKRPVITERSADL-MTEKKYTFEVDVRANKTEVKDAVESIFGVKVDKVNIMNYKGKSKR  65

Query  69  FGKTLGRRSDVKKAYVTLKA  88
            G+  G  S  +KA V L A
Sbjct  66  VGRYTGMTSRRRKAIVKLTA  85


> P04454 50S ribosomal protein L23 [Geobacillus stearothermophilus]
Length=95

 Score = 59.7 bits (143),  Expect = 4e-16
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 3/79 (4%)

Query  9   VLKGPVFSEKAQ-VLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKSK  67
           ++K P+ +E    ++G+      F+VD+ A K E+K AVEK+FGV V KVN    KGK K
Sbjct  7   IIKRPIITENTMNLIGQKK--YTFEVDVKANKTEVKDAVEKIFGVKVEKVNIMNYKGKFK  64

Query  68  RFGKTLGRRSDVKKAYVTL  86
           R G+  G  +  KKA VTL
Sbjct  65  RVGRYSGYTNRRKKAIVTL  83


> P38512 50S ribosomal protein L23 [Thermotoga maritima (strain 
ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)]
Length=100

 Score = 58.2 bits (139),  Expect = 2e-15
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 1/88 (1%)

Query  6   IYQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGK  65
           ++ VL  P+ +EKA +L E     VF+V+  A K  +K+AVEKLF V V KVN    K K
Sbjct  8   LHDVLIRPIITEKALILREQRKY-VFEVNPLANKNLVKEAVEKLFNVKVEKVNILNMKPK  66

Query  66  SKRFGKTLGRRSDVKKAYVTLKAGQDVE  93
            KR G   G+    KKA VTLK G  ++
Sbjct  67  PKRRGIFEGKTRSWKKAVVTLKEGYTIK  94


> P04456 60S ribosomal protein L25 [Saccharomyces cerevisiae (strain 
ATCC 204508 / S288c)]
Length=142

 Score = 58.5 bits (140),  Expect = 2e-15
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 13/85 (15%)

Query  7    YQVLKGPVFSEKAQVLGETAGVQVFKVDINATKLEIKKAVEKLFGVDVLKVNTTITKGKS  66
            Y+V++ P+ SE A    E   + VF+V + A K +IKKAV++L+ VDVLKVNT +     
Sbjct  60   YKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLV-----  114

Query  67   KRFGKTLGRRSDVKKAYVTLKAGQD  91
                    R +  KKAYV L A  D
Sbjct  115  --------RPNGTKKAYVRLTADYD  131



Lambda      K        H        a         alpha
   0.318    0.134    0.358    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 152076


  Database: e4759b76e54e01068776adffffef875b.SwissProt.fasta
    Posted date:  Sep 26, 2020  8:09 PM
  Number of letters in database: 2,838
  Number of sequences in database:  27



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40