ACIAD3218 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: daff675830758b94e9cc866c2aff6f93.TrEMBL.fasta
           36 sequences; 7,260 total letters



Query= ACIAD3218

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A1L6KJR7 50S ribosomal protein L4 [Acinetobacter haemolyticus]     385    4e-140
  N9AIR9 50S ribosomal protein L4 [Acinetobacter soli NIPH 2899]       384    9e-140
  A0A1P8EK95 50S ribosomal protein L4 [Acinetobacter soli]             384    9e-140
  A0A0M1I8E9 50S ribosomal protein L4 [Acinetobacter sp. C15]          384    9e-140
  A0A022IYU9 50S ribosomal protein L4 [Acinetobacter sp. 1564232]      383    3e-139
  A0A009HDG5 50S ribosomal protein L4 [Acinetobacter sp. 1289694]      383    3e-139
  A0A014DN59 50S ribosomal protein L4 [Acinetobacter sp. 25977_10]     383    3e-139
  A0A0B2XI61 50S ribosomal protein L4 [Acinetobacter baumannii]        383    3e-139
  N9DJL8 50S ribosomal protein L4 [Acinetobacter ursingii ANC 3649]    382    5e-139
  A0A009YJK9 50S ribosomal protein L4 [Acinetobacter sp. 479375]       382    5e-139
  N9SEX3 50S ribosomal protein L4 [Acinetobacter ursingii NIPH 706]    382    5e-139
  A0A2S4T440 50S ribosomal protein L4 [Acinetobacter calcoaceticu...   381    1e-138
  N9K0I2 50S ribosomal protein L4 [Acinetobacter baumannii NIPH 80]    381    1e-138
  A0A0J1A3W2 50S ribosomal protein L4 [Acinetobacter baumannii MR...   381    1e-138
  A0A013TEI4 50S ribosomal protein L4 [Acinetobacter sp. 742879]       380    6e-138
  U7GPD1 50S ribosomal protein L4 [Acinetobacter sp. COS3]             380    6e-138
  G7GC75 50S ribosomal protein L4 [Acinetobacter sp. NBRC 100985]      380    6e-138
  A0A150HPC3 50S ribosomal protein L4 [Acinetobacter venetianus]       380    6e-138
  S7WH54 50S ribosomal protein L4 [Acinetobacter junii MTCC 11364]     380    6e-138
  A0A1F2VCF0 50S ribosomal protein L4 [Acinetobacter sp. GWC1_38_13]   380    6e-138
  A0A2R4ULX4 50S ribosomal protein L4 [Acinetobacter junii]            380    6e-138
  N9LN10 50S ribosomal protein L4 [Acinetobacter sp. NIPH 298]         379    8e-138
  N8R449 50S ribosomal protein L4 [Acinetobacter sp. CIP-A165]         379    8e-138
  S3PPM4 50S ribosomal protein L4 [Acinetobacter rudis CIP 110305]     379    2e-137
  A0A2U3MUI3 50S ribosomal protein L4 [Acinetobacter sp. KPC-SM-21]    379    2e-137
  D0FH59 50S ribosomal protein L4 [Staphylococcus epidermidis]         149    2e-47 
  H9BQQ1 50S ribosomal protein L4 [Staphylococcus pettenkoferi]        148    4e-47 
  D0FH61 50S ribosomal protein L4 [Staphylococcus epidermidis]         148    5e-47 
  D0FH57 50S ribosomal protein L4 [Staphylococcus epidermidis]         146    3e-46 
  D0FH60 50S ribosomal protein L4 [Staphylococcus epidermidis]         146    3e-46 
  D0FH58 50S ribosomal protein L4 [Staphylococcus epidermidis]         143    3e-45 
  C5HDG2 50S ribosomal protein L4 [Corynebacterium otitidis]           137    1e-42 
  B9UM19 Ribosomal protein L4 [Mycobacteroides abscessus]              130    4e-40 
  B9UM17 Ribosomal protein L4 [Mycobacteroides abscessus subsp. b...   130    4e-40 
  B9UM18 Ribosomal protein L4 [Mycobacteroides abscessus subsp. b...   129    8e-40 
  B9UM20 Ribosomal protein L4 [Mycobacteroides chelonae]               129    1e-39 


> A0A1L6KJR7 50S ribosomal protein L4 [Acinetobacter haemolyticus]
Length=205

 Score =  385 bits (990),  Expect = 4e-140
 Identities = 198/205 (97%), Positives = 201/205 (98%), Gaps = 0/205 (0%)

Query  1    LRGNNVNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGG  60
            +RGN VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGG
Sbjct  1    MRGNTVNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGG  60

Query  61   KKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD  120
            KKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD
Sbjct  61   KKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD  120

Query  121  RLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAID  180
            RLVLVEEFAVAAPKTKELLAKL DLNA RALI+TDAVDENLYLAARNLPHVDVVDATAID
Sbjct  121  RLVLVEEFAVAAPKTKELLAKLTDLNATRALIITDAVDENLYLAARNLPHVDVVDATAID  180

Query  181  PVSLIAFDKVVMSVAAAKKIEVELG  205
            PVSLIAFDKVVMSVAAAKKIEVELG
Sbjct  181  PVSLIAFDKVVMSVAAAKKIEVELG  205


> N9AIR9 50S ribosomal protein L4 [Acinetobacter soli NIPH 2899]
Length=200

 Score =  384 bits (987),  Expect = 9e-140
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A1P8EK95 50S ribosomal protein L4 [Acinetobacter soli]
Length=200

 Score =  384 bits (987),  Expect = 9e-140
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A0M1I8E9 50S ribosomal protein L4 [Acinetobacter sp. C15]
Length=200

 Score =  384 bits (987),  Expect = 9e-140
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A022IYU9 50S ribosomal protein L4 [Acinetobacter sp. 1564232]
Length=200

 Score =  383 bits (984),  Expect = 3e-139
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A009HDG5 50S ribosomal protein L4 [Acinetobacter sp. 1289694]
Length=200

 Score =  383 bits (984),  Expect = 3e-139
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A014DN59 50S ribosomal protein L4 [Acinetobacter sp. 25977_10]
Length=200

 Score =  383 bits (984),  Expect = 3e-139
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A0B2XI61 50S ribosomal protein L4 [Acinetobacter baumannii]
Length=200

 Score =  383 bits (984),  Expect = 3e-139
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> N9DJL8 50S ribosomal protein L4 [Acinetobacter ursingii ANC 3649]
Length=200

 Score =  382 bits (982),  Expect = 5e-139
 Identities = 198/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDA AIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDAAAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A009YJK9 50S ribosomal protein L4 [Acinetobacter sp. 479375]
Length=200

 Score =  382 bits (982),  Expect = 5e-139
 Identities = 198/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDA AIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDAAAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> N9SEX3 50S ribosomal protein L4 [Acinetobacter ursingii NIPH 
706]
Length=200

 Score =  382 bits (982),  Expect = 5e-139
 Identities = 198/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDA AIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDAAAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A2S4T440 50S ribosomal protein L4 [Acinetobacter calcoaceticus/baumannii 
complex sp. ABNIH27]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> N9K0I2 50S ribosomal protein L4 [Acinetobacter baumannii NIPH 
80]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A0J1A3W2 50S ribosomal protein L4 [Acinetobacter baumannii 
MRSN 3527]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A013TEI4 50S ribosomal protein L4 [Acinetobacter sp. 742879]
Length=198

 Score =  380 bits (975),  Expect = 6e-138
 Identities = 196/198 (99%), Positives = 198/198 (100%), Gaps = 0/198 (0%)

Query  8    LKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQK  67
            +KTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFRQK
Sbjct  1    MKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFRQK  60

Query  68   GTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEE  127
            GTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEE
Sbjct  61   GTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEE  120

Query  128  FAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAF  187
            FAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAF
Sbjct  121  FAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAF  180

Query  188  DKVVMSVAAAKKIEVELG  205
            DKVVMSVAAAKKIEVELG
Sbjct  181  DKVVMSVAAAKKIEVELG  198


> U7GPD1 50S ribosomal protein L4 [Acinetobacter sp. COS3]
Length=200

 Score =  380 bits (975),  Expect = 6e-138
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSG+AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGAAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARN+PHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNIPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> G7GC75 50S ribosomal protein L4 [Acinetobacter sp. NBRC 100985]
Length=200

 Score =  380 bits (975),  Expect = 6e-138
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSG+AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGAAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARN+PHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNIPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A150HPC3 50S ribosomal protein L4 [Acinetobacter venetianus]
Length=200

 Score =  380 bits (975),  Expect = 6e-138
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSG+AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGAAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARN+PHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNIPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> S7WH54 50S ribosomal protein L4 [Acinetobacter junii MTCC 11364]
Length=200

 Score =  380 bits (975),  Expect = 6e-138
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A1F2VCF0 50S ribosomal protein L4 [Acinetobacter sp. GWC1_38_13]
Length=200

 Score =  380 bits (975),  Expect = 6e-138
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A2R4ULX4 50S ribosomal protein L4 [Acinetobacter junii]
Length=200

 Score =  380 bits (975),  Expect = 6e-138
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> N9LN10 50S ribosomal protein L4 [Acinetobacter sp. NIPH 298]
Length=200

 Score =  379 bits (974),  Expect = 8e-138
 Identities = 195/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALI+TDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIITDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> N8R449 50S ribosomal protein L4 [Acinetobacter sp. CIP-A165]
Length=200

 Score =  379 bits (974),  Expect = 8e-138
 Identities = 195/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALI+TDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIITDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> S3PPM4 50S ribosomal protein L4 [Acinetobacter rudis CIP 110305]
Length=200

 Score =  379 bits (972),  Expect = 2e-137
 Identities = 195/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQG+RAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGSRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARNLPHVDVVDATAIDPV LI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNLPHVDVVDATAIDPVGLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A0A2U3MUI3 50S ribosomal protein L4 [Acinetobacter sp. KPC-SM-21]
Length=200

 Score =  379 bits (972),  Expect = 2e-137
 Identities = 195/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQG+RAQKSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGSRAQKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNA RALIVTDAVDENLYLAARNLPHVDVVDATAIDPV LI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNATRALIVTDAVDENLYLAARNLPHVDVVDATAIDPVGLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> D0FH59 50S ribosomal protein L4 [Staphylococcus epidermidis]
Length=207

 Score =  149 bits (376),  Expect = 2e-47
 Identities = 82/201 (41%), Positives = 126/201 (63%), Gaps = 4/201 (2%)

Query  5    NVNLKTVSGS---AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGK  61
            N ++  V GS   +VEL++  F  E N +++ + +    A  RQGT A K+R+ V GGG+
Sbjct  3    NYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGGGR  62

Query  62   KPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDR  121
            KP+RQKGTGRAR G+IR+P W GGG  F   P+ ++ K+ +KM R A++  L+  V+++ 
Sbjct  63   KPWRQKGTGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQENS  122

Query  122  LVLVEEFAVAAPKTKELLAKLNDL-NAARALIVTDAVDENLYLAARNLPHVDVVDATAID  180
              +V+ F   APKTKE    L  L    + L+VT++ D N+ L+ARN+P V V  A  ++
Sbjct  123  FTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTESEDVNVELSARNIPGVQVTTAQGLN  182

Query  181  PVSLIAFDKVVMSVAAAKKIE  201
             + L + D V+++ AAAKK+E
Sbjct  183  VLDLTSADSVIITEAAAKKVE  203


> H9BQQ1 50S ribosomal protein L4 [Staphylococcus pettenkoferi]
Length=207

 Score =  148 bits (374),  Expect = 4e-47
 Identities = 83/205 (40%), Positives = 128/205 (62%), Gaps = 4/205 (2%)

Query  5    NVNLKTVSGS---AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGK  61
            N ++  V+GS   +VEL++  F  E N  ++ + +    A  RQGT + K+R+EV GGG+
Sbjct  3    NYDVVKVNGSKSGSVELNDAVFAIEPNNDVLFEAINLQRASLRQGTHSVKNRSEVRGGGR  62

Query  62   KPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDR  121
            KP+RQKGTGRAR G+IR+P W GGG  F   P+ +S K+ +KM R A++  L+  V+++ 
Sbjct  63   KPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSYKVQENG  122

Query  122  LVLVEEFAVAAPKTKELLAKLNDL-NAARALIVTDAVDENLYLAARNLPHVDVVDATAID  180
              +V+ F   APKTKE    L +L    + L+V +  D N+ L+ARN+P V V  A  ++
Sbjct  123  FTVVDAFNFDAPKTKEFKNVLTNLEQPKKVLVVVEGEDVNVELSARNIPGVQVTTAEGLN  182

Query  181  PVSLIAFDKVVMSVAAAKKIEVELG  205
             + + + D V+++ AAAKK+E  LG
Sbjct  183  VLDISSADSVIITEAAAKKVEEVLG  207


> D0FH61 50S ribosomal protein L4 [Staphylococcus epidermidis]
Length=207

 Score =  148 bits (373),  Expect = 5e-47
 Identities = 82/201 (41%), Positives = 125/201 (62%), Gaps = 4/201 (2%)

Query  5    NVNLKTVSGS---AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGK  61
            N ++  V GS   +VEL++  F  E N +++ + +    A  RQGT A K+R+ V GGG+
Sbjct  3    NYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGGGR  62

Query  62   KPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDR  121
            KP+RQKGTGRAR G+IR+P W GGG  F   P+ ++ K+ +KM R A++  L+  V+++ 
Sbjct  63   KPWRQKGTGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQENS  122

Query  122  LVLVEEFAVAAPKTKELLAKLNDL-NAARALIVTDAVDENLYLAARNLPHVDVVDATAID  180
              +V+ F   APKTKE    L  L    + L+VT+  D N+ L+ARN+P V V  A  ++
Sbjct  123  FTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGLN  182

Query  181  PVSLIAFDKVVMSVAAAKKIE  201
             + L + D V+++ AAAKK+E
Sbjct  183  VLDLTSADSVIITEAAAKKVE  203


> D0FH57 50S ribosomal protein L4 [Staphylococcus epidermidis]
Length=207

 Score =  146 bits (368),  Expect = 3e-46
 Identities = 81/201 (40%), Positives = 124/201 (62%), Gaps = 4/201 (2%)

Query  5    NVNLKTVSGS---AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGK  61
            N ++  V GS   +VEL++  F  E N +++ + +    A  RQGT A K+R+ V GGG+
Sbjct  3    NYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGGGR  62

Query  62   KPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDR  121
            KP+RQ GTGRAR G+IR+P W GGG  F   P+ ++ K+ +KM R A++  L+  V+++ 
Sbjct  63   KPWRQNGTGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQENS  122

Query  122  LVLVEEFAVAAPKTKELLAKLNDL-NAARALIVTDAVDENLYLAARNLPHVDVVDATAID  180
              +V+ F   APKTKE    L  L    + L+VT+  D N+ L+ARN+P V V  A  ++
Sbjct  123  FTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGLN  182

Query  181  PVSLIAFDKVVMSVAAAKKIE  201
             + L + D V+++ AAAKK+E
Sbjct  183  VLDLTSADSVIITEAAAKKVE  203


> D0FH60 50S ribosomal protein L4 [Staphylococcus epidermidis]
Length=208

 Score =  146 bits (368),  Expect = 3e-46
 Identities = 82/202 (41%), Positives = 126/202 (62%), Gaps = 5/202 (2%)

Query  5    NVNLKTVSGS---AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGK  61
            N ++  V GS   +VEL++  F  E N +++ + +    A  RQGT A K+R+ V GGG+
Sbjct  3    NYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGGGR  62

Query  62   KPFRQKGTG-RARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD  120
            KP+RQKGTG RAR G+IR+P W GGG  F   P+ ++ K+ +KM R A++  L+  V+++
Sbjct  63   KPWRQKGTGGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRSALRSALSFKVQEN  122

Query  121  RLVLVEEFAVAAPKTKELLAKLNDL-NAARALIVTDAVDENLYLAARNLPHVDVVDATAI  179
               +V+ F   APKTKE    L  L    + L+VT++ D N+ L+ARN+P V V  A  +
Sbjct  123  SFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTESEDVNVELSARNIPGVQVTTAQGL  182

Query  180  DPVSLIAFDKVVMSVAAAKKIE  201
            + + L + D V+++ AAAKK+E
Sbjct  183  NVLDLTSADSVIITEAAAKKVE  204


> D0FH58 50S ribosomal protein L4 [Staphylococcus epidermidis]
Length=208

 Score =  143 bits (361),  Expect = 3e-45
 Identities = 82/202 (41%), Positives = 125/202 (62%), Gaps = 5/202 (2%)

Query  5    NVNLKTVSGS---AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGK  61
            N ++  V GS   +VEL++  F  E N +++ + +    A  RQGT A K+R+ V GGG+
Sbjct  3    NYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGGGR  62

Query  62   KPFRQKGTG-RARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD  120
            KP+RQKGTG RAR G+IR+P W GGG  F   P+ ++ K+ +KM R A++  L+  V+++
Sbjct  63   KPWRQKGTGGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQEN  122

Query  121  RLVLVEEFAVAAPKTKELLAKLNDL-NAARALIVTDAVDENLYLAARNLPHVDVVDATAI  179
               +V+ F   APKTKE    L  L    + L+VT+  D N+ L+ARN+P V V  A  +
Sbjct  123  SFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGL  182

Query  180  DPVSLIAFDKVVMSVAAAKKIE  201
            + + L + D V+++ AAAKK+E
Sbjct  183  NVLDLTSADSVIITEAAAKKVE  204


> C5HDG2 50S ribosomal protein L4 [Corynebacterium otitidis]
Length=217

 Score =  137 bits (344),  Expect = 1e-42
 Identities = 81/183 (44%), Positives = 106/183 (58%), Gaps = 2/183 (1%)

Query  16   VELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARAG  75
            VEL    F RE +  L HQVV A LA  RQGT + K+R EV GGGKKP+RQKGTGRAR G
Sbjct  19   VELPSEIFEREASIELTHQVVVAQLAAARQGTHSTKTRGEVRGGGKKPYRQKGTGRARQG  78

Query  76   SIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAA-PK  134
            SIR+P + GGG     +P+D+SQ+  +KM R A+   L+     DR+ +VEE      P 
Sbjct  79   SIRAPQFTGGGIVHGPKPRDYSQRTPKKMKRAALHGALSNRAANDRIHVVEELVPGTKPS  138

Query  135  TKELLAKLNDLNAAR-ALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMS  193
            TK   + L  L   +  L+V  A D N   +A NLP V ++  + ++   +I  D VV S
Sbjct  139  TKAARSFLERLTGRKNVLLVVQAEDLNARRSANNLPDVHILVPSQLNTYDVIKSDDVVFS  198

Query  194  VAA  196
             AA
Sbjct  199  KAA  201


> B9UM19 Ribosomal protein L4 [Mycobacteroides abscessus]
Length=199

 Score =  130 bits (326),  Expect = 4e-40
 Identities = 77/184 (42%), Positives = 109/184 (59%), Gaps = 2/184 (1%)

Query  15   AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARA  74
            ++EL    F    N AL+HQVVTA LA GRQGT + K+R  VSGGGKKP+RQKGTGRAR 
Sbjct  6    SIELPAELFDAPANIALLHQVVTAQLAAGRQGTHSTKTRGLVSGGGKKPYRQKGTGRARQ  65

Query  75   GSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEF-AVAAP  133
            GS R+P + GGG     +P+D+SQ+  +KM   A++  L++  R  R+  V E  A   P
Sbjct  66   GSTRAPQFTGGGIVHGPQPRDYSQRTPKKMIAAALRGALSDRARNGRIHAVTELVAGQEP  125

Query  134  KTKELLAKLNDLNAARALIVTDAVDENLYL-AARNLPHVDVVDATAIDPVSLIAFDKVVM  192
             TK   + L ++   + L+V    D+   + + RNLP+V V+    ++   ++  D VV 
Sbjct  126  STKSAKSFLGEITDRKQLLVVLGRDDLASVKSVRNLPNVHVLAYDQLNTYDVLKADDVVF  185

Query  193  SVAA  196
            SV A
Sbjct  186  SVEA  189


> B9UM17 Ribosomal protein L4 [Mycobacteroides abscessus subsp. 
bolletii]
Length=199

 Score =  130 bits (326),  Expect = 4e-40
 Identities = 77/184 (42%), Positives = 109/184 (59%), Gaps = 2/184 (1%)

Query  15   AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARA  74
            ++EL    F    N AL+HQVVTA LA GRQGT + K+R  VSGGGKKP+RQKGTGRAR 
Sbjct  6    SIELPAELFDAPANIALLHQVVTAQLAAGRQGTHSTKTRGLVSGGGKKPYRQKGTGRARQ  65

Query  75   GSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEF-AVAAP  133
            GS R+P + GGG     +P+D+SQ+  +KM   A++  L++  R  R+  V E  A   P
Sbjct  66   GSTRAPQFTGGGIVHGPQPRDYSQRTPKKMIAAALRGALSDRARNGRIHAVTELVAGQEP  125

Query  134  KTKELLAKLNDLNAARALIVTDAVDENLYL-AARNLPHVDVVDATAIDPVSLIAFDKVVM  192
             TK   + L ++   + L+V    D+   + + RNLP+V V+    ++   ++  D VV 
Sbjct  126  STKSAKSFLGEITDRKQLLVVLGRDDLASVKSVRNLPNVHVLAYDQLNTYDVLKADDVVF  185

Query  193  SVAA  196
            SV A
Sbjct  186  SVEA  189


> B9UM18 Ribosomal protein L4 [Mycobacteroides abscessus subsp. 
bolletii]
Length=199

 Score =  129 bits (324),  Expect = 8e-40
 Identities = 77/184 (42%), Positives = 109/184 (59%), Gaps = 2/184 (1%)

Query  15   AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARA  74
            ++EL    F    N AL+HQVVTA LA GRQGT + K+R  VSGGGKKP+RQKGTGRAR 
Sbjct  6    SIELPAELFDAPANIALLHQVVTAQLAAGRQGTHSTKTRGLVSGGGKKPYRQKGTGRARQ  65

Query  75   GSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEF-AVAAP  133
            GS R+P + GGG     +P+D+SQ+  +KM   A++  L++  R  R+  V E  A   P
Sbjct  66   GSTRAPQFTGGGIVHGPQPRDYSQRTPKKMIAAALRGALSDRARNGRIHAVTELVAGQEP  125

Query  134  KTKELLAKLNDLNAARALIVTDAVDENLYL-AARNLPHVDVVDATAIDPVSLIAFDKVVM  192
             TK   + L ++   + L+V    D+   + + RNLP+V V+    ++   ++  D VV 
Sbjct  126  STKSAKSFLAEITDRKQLLVVLGRDDLASVKSVRNLPNVHVLAYDQLNTYDVLKADDVVF  185

Query  193  SVAA  196
            SV A
Sbjct  186  SVEA  189


> B9UM20 Ribosomal protein L4 [Mycobacteroides chelonae]
Length=199

 Score =  129 bits (323),  Expect = 1e-39
 Identities = 75/186 (40%), Positives = 107/186 (58%), Gaps = 6/186 (3%)

Query  15   AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARA  74
            ++EL    F    N AL+HQVVTA LA GRQGT + K+R  VSGGGKKP+RQKGTGRAR 
Sbjct  6    SIELPAELFDAPANIALLHQVVTAQLAAGRQGTHSTKTRGLVSGGGKKPYRQKGTGRARQ  65

Query  75   GSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAV----  130
            GS R+P + GGG     +P+D+SQ+  +KM   A++  L++  R  R+  + E       
Sbjct  66   GSTRAPQFTGGGIVHGPQPRDYSQRTPKKMIAAALRGALSDRARNGRIHAITELVAGQEP  125

Query  131  AAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKV  190
            +    K  LA+++D    + L+V    D     + RNLP+V V+    ++   ++  D V
Sbjct  126  STKSAKSFLAEISD--RKQVLVVLGRDDLTSVKSVRNLPNVHVLAYDQLNTYDVLKADDV  183

Query  191  VMSVAA  196
            V SV A
Sbjct  184  VFSVEA  189



Lambda      K        H        a         alpha
   0.320    0.134    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 919512


  Database: daff675830758b94e9cc866c2aff6f93.TrEMBL.fasta
    Posted date:  Sep 24, 2020  3:24 AM
  Number of letters in database: 7,260
  Number of sequences in database:  36



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40