ACIAD3218 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 6d7437082cb81688f955cab1c409f78d.SwissProt.fasta
           25 sequences; 5,035 total letters



Query= ACIAD3218

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F7R3 50S ribosomal protein L4 [Acinetobacter baylyi (strain A...   395    4e-144
  B7IA38 50S ribosomal protein L4 [Acinetobacter baumannii (strai...   381    1e-138
  B2HZM1 50S ribosomal protein L4 [Acinetobacter baumannii (strai...   381    1e-138
  B0VQR9 50S ribosomal protein L4 [Acinetobacter baumannii (strai...   381    1e-138
  A3M982 50S ribosomal protein L4 [Acinetobacter baumannii (strai...   381    1e-138
  B0V6W9 50S ribosomal protein L4 [Acinetobacter baumannii (strai...   381    1e-138
  A5WCJ1 50S ribosomal protein L4 [Psychrobacter sp. (strain PRwf...   322    2e-115
  Q4FUF5 50S ribosomal protein L4 [Psychrobacter arcticus (strain...   321    7e-115
  Q1QDI5 50S ribosomal protein L4 [Psychrobacter cryohalolentis (...   320    1e-114
  Q1R0H4 50S ribosomal protein L4 [Chromohalobacter salexigens (s...   280    6e-99 
  Q2S913 50S ribosomal protein L4 [Hahella chejuensis (strain KCT...   279    2e-98 
  Q0VSK2 50S ribosomal protein L4 [Alcanivorax borkumensis (strai...   276    2e-97 
  A1T0E1 50S ribosomal protein L4 [Psychromonas ingrahamii (strai...   275    5e-97 
  C4L7T1 50S ribosomal protein L4 [Tolumonas auensis (strain DSM ...   274    2e-96 
  Q9KNY5 50S ribosomal protein L4 [Vibrio cholerae serotype O1 (s...   266    2e-93 
  P44345 50S ribosomal protein L4 [Haemophilus influenzae (strain...   265    9e-93 
  P60723 50S ribosomal protein L4 [Escherichia coli (strain K12)]      263    3e-92 
  P60726 50S ribosomal protein L4 [Salmonella typhimurium (strain...   263    3e-92 
  Q9HWD6 50S ribosomal protein L4 [Pseudomonas aeruginosa (strain...   262    1e-91 
  P55836 50S ribosomal protein L4 [Aggregatibacter actinomycetemc...   261    3e-91 
  P49226 50S ribosomal protein L4 [Morganella morganii]                259    8e-91 
  P60731 50S ribosomal protein L4 [Yersinia pseudotuberculosis se...   258    2e-90 
  P28601 50S ribosomal protein L4 [Geobacillus stearothermophilus]     168    7e-55 
  P42921 50S ribosomal protein L4 [Bacillus subtilis (strain 168)]     148    4e-47 
  P0C0D5 50S ribosomal protein L4 [Streptococcus pyogenes]             145    3e-46 


> Q6F7R3 50S ribosomal protein L4 [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=205

 Score =  395 bits (1015),  Expect = 4e-144
 Identities = 204/205 (99%), Positives = 205/205 (100%), Gaps = 0/205 (0%)

Query  1    LRGNNVNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGG  60
            +RGNNVNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGG
Sbjct  1    MRGNNVNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGG  60

Query  61   KKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD  120
            KKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD
Sbjct  61   KKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQD  120

Query  121  RLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAID  180
            RLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAID
Sbjct  121  RLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAID  180

Query  181  PVSLIAFDKVVMSVAAAKKIEVELG  205
            PVSLIAFDKVVMSVAAAKKIEVELG
Sbjct  181  PVSLIAFDKVVMSVAAAKKIEVELG  205


> B7IA38 50S ribosomal protein L4 [Acinetobacter baumannii (strain 
AB0057)]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> B2HZM1 50S ribosomal protein L4 [Acinetobacter baumannii (strain 
ACICU)]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> B0VQR9 50S ribosomal protein L4 [Acinetobacter baumannii (strain 
SDF)]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A3M982 50S ribosomal protein L4 [Acinetobacter baumannii (strain 
ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> B0V6W9 50S ribosomal protein L4 [Acinetobacter baumannii (strain 
AYE)]
Length=200

 Score =  381 bits (979),  Expect = 1e-138
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRA KSRA+VSGGGKKPFR
Sbjct  1    MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV
Sbjct  61   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI
Sbjct  121  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            AFDKVVMSVAAAKKIEVELG
Sbjct  181  AFDKVVMSVAAAKKIEVELG  200


> A5WCJ1 50S ribosomal protein L4 [Psychrobacter sp. (strain PRwf-1)]
Length=200

 Score =  322 bits (825),  Expect = 2e-115
 Identities = 160/199 (80%), Positives = 181/199 (91%), Gaps = 0/199 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NLKTV+G+AVELS+ AFGREFNEALVHQVVTAYLAG RQGTRAQK+RAEVSGGGKKP+R
Sbjct  1    MNLKTVTGAAVELSDTAFGREFNEALVHQVVTAYLAGARQGTRAQKTRAEVSGGGKKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGS RSPIWVGGG+ FAA+PQDWSQKVNRKMYRGAMQCILAELVRQDRL+LV
Sbjct  61   QKGTGRARAGSTRSPIWVGGGRAFAAKPQDWSQKVNRKMYRGAMQCILAELVRQDRLILV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            +   V+APKTKEL++KL +LNA RALIVT+ VDENLYLAARN+PHV+V+    +DPVSLI
Sbjct  121  DSITVSAPKTKELISKLAELNAPRALIVTNEVDENLYLAARNIPHVNVLGTNEVDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVEL  204
            AFDKV+MSV AAK+ E  L
Sbjct  181  AFDKVIMSVDAAKQFEEAL  199


> Q4FUF5 50S ribosomal protein L4 [Psychrobacter arcticus (strain 
DSM 17307 / 273-4)]
Length=200

 Score =  321 bits (822),  Expect = 7e-115
 Identities = 159/199 (80%), Positives = 182/199 (91%), Gaps = 0/199 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            ++LKTV+G+AVELS+ AFGREFNEALVHQVVTAYLAG RQGTRAQK+RAEVSGGG KP+R
Sbjct  1    MDLKTVTGAAVELSDTAFGREFNEALVHQVVTAYLAGARQGTRAQKTRAEVSGGGIKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIW GGG+ FAA+PQDWSQKVNRKMYRGAMQCILAEL+RQ+RL+LV
Sbjct  61   QKGTGRARAGSIRSPIWRGGGRAFAAKPQDWSQKVNRKMYRGAMQCILAELIRQERLILV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EE +V+ PKTKEL+AKLN+L A RALIVT  VDENLYLAARN+PHV+V+D + +DPVSLI
Sbjct  121  EEISVSGPKTKELIAKLNELGAPRALIVTKEVDENLYLAARNIPHVNVLDTSEVDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVEL  204
            AFDKV+MSV AAK+ E  L
Sbjct  181  AFDKVIMSVEAAKQFEEAL  199


> Q1QDI5 50S ribosomal protein L4 [Psychrobacter cryohalolentis 
(strain K5)]
Length=200

 Score =  320 bits (821),  Expect = 1e-114
 Identities = 158/199 (79%), Positives = 183/199 (92%), Gaps = 0/199 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            ++LKTV+G+AVELS+ AFGREFNEALVHQVVTAYLAG RQGTRAQK+RAEVSGGG KP+R
Sbjct  1    MDLKTVTGAAVELSDTAFGREFNEALVHQVVTAYLAGARQGTRAQKTRAEVSGGGIKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAGSIRSPIW GGG+ FAA+PQDWSQKVNRKMYRGAMQCILAEL+RQ+RL+LV
Sbjct  61   QKGTGRARAGSIRSPIWRGGGRAFAAKPQDWSQKVNRKMYRGAMQCILAELIRQERLILV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            EE +V+ PKTKEL+AKL +LNA+RALIVT  VDENLYLAARN+PHV+V+D + +DPVSLI
Sbjct  121  EEISVSGPKTKELIAKLGELNASRALIVTKEVDENLYLAARNIPHVNVLDTSEVDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVEL  204
            AFDKV+M+V AAK+ E  L
Sbjct  181  AFDKVIMTVEAAKQFEEAL  199


> Q1R0H4 50S ribosomal protein L4 [Chromohalobacter salexigens 
(strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)]
Length=202

 Score =  280 bits (717),  Expect = 6e-99
 Identities = 137/201 (68%), Positives = 170/201 (85%), Gaps = 0/201 (0%)

Query  5    NVNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPF  64
            N+NL       VE+S+  FG+EFNE+LVHQVVTAY A GRQGTRAQK+R+EV GGGKKP+
Sbjct  2    NLNLAGADAGTVEVSDATFGKEFNESLVHQVVTAYFAAGRQGTRAQKTRSEVRGGGKKPW  61

Query  65   RQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVL  124
            RQKGTGRARAG+IRSP+W  GG TFAARPQD++QKVNRKMYR AM+ IL+ELVRQ+RLV+
Sbjct  62   RQKGTGRARAGTIRSPLWRSGGVTFAARPQDYTQKVNRKMYRAAMRSILSELVRQERLVV  121

Query  125  VEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSL  184
            V+ F V APKTK+L+AKL DL+  +ALIVT+ +DE L+LAARN+P+VDVVD  A DPVSL
Sbjct  122  VDSFEVDAPKTKQLVAKLKDLDLEKALIVTEDIDEKLFLAARNIPYVDVVDVAAADPVSL  181

Query  185  IAFDKVVMSVAAAKKIEVELG  205
            +AFDKV+++V+A +K E +LG
Sbjct  182  VAFDKVLVTVSALRKFEEKLG  202


> Q2S913 50S ribosomal protein L4 [Hahella chejuensis (strain KCTC 
2396)]
Length=202

 Score =  279 bits (714),  Expect = 2e-98
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 3/199 (2%)

Query  10   TVSGSA---VELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQ  66
            T++G+    V +S+VAF R+FNEALVHQVVTAYLAGGRQG++AQK+R++VSGGGKKP+RQ
Sbjct  4    TINGAGKGTVSVSDVAFARDFNEALVHQVVTAYLAGGRQGSKAQKTRSQVSGGGKKPWRQ  63

Query  67   KGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVE  126
            KG+GRARAG+IRSPIW GGGKTFAA P D SQKVN+KMYR AMQ IL+ELVRQ+RLV+VE
Sbjct  64   KGSGRARAGTIRSPIWRGGGKTFAATPLDHSQKVNKKMYRAAMQSILSELVRQERLVVVE  123

Query  127  EFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIA  186
            E AV APKTK+  AKL DL     LIV DAVD+NLYLA+RN+PHVDV DA AI+PVSLIA
Sbjct  124  EMAVEAPKTKQFNAKLKDLGLENVLIVADAVDQNLYLASRNIPHVDVCDAVAINPVSLIA  183

Query  187  FDKVVMSVAAAKKIEVELG  205
             DKV+++V+A KKIE  LG
Sbjct  184  HDKVLVTVSALKKIEEMLG  202


> Q0VSK2 50S ribosomal protein L4 [Alcanivorax borkumensis (strain 
ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)]
Length=200

 Score =  276 bits (707),  Expect = 2e-97
 Identities = 136/199 (68%), Positives = 169/199 (85%), Gaps = 0/199 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            +NL T SG  V +SEVAFG++FNE LVHQVVTA+LAG RQG++AQK+R++VSGGG+KP+R
Sbjct  1    MNLNTASGGTVTVSEVAFGKDFNEPLVHQVVTAFLAGARQGSKAQKNRSDVSGGGRKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAG+IRSPIW GGGKTFAA P+D SQKVNRKMYRGA+QCI++ELVRQ+RLV+V
Sbjct  61   QKGTGRARAGTIRSPIWRGGGKTFAAVPRDHSQKVNRKMYRGALQCIMSELVRQERLVVV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            +EF V +PKTK + AKL  +     LIVTD VDENL++A+RNLP VDV D+  +DPVSLI
Sbjct  121  DEFTVDSPKTKAVAAKLKGMELTSVLIVTDNVDENLFMASRNLPKVDVRDSQGVDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVEL  204
            AF+KV+++V A KK+E  L
Sbjct  181  AFEKVLITVPALKKLEEAL  199


> A1T0E1 50S ribosomal protein L4 [Psychromonas ingrahamii (strain 
37)]
Length=201

 Score =  275 bits (704),  Expect = 5e-97
 Identities = 139/191 (73%), Positives = 165/191 (86%), Gaps = 0/191 (0%)

Query  14   SAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRAR  73
            SA+E+SE  FGREFNEALVHQVV AY AG RQGTRAQK+R++VSGGGKKP+RQKGTGRAR
Sbjct  10   SALEVSETTFGREFNEALVHQVVVAYAAGARQGTRAQKTRSDVSGGGKKPWRQKGTGRAR  69

Query  74   AGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAP  133
            +G+IRSPIWVGGG TFAARPQD SQKVN+KMYRGA++ IL+ELVRQDRL++VE+F+V AP
Sbjct  70   SGTIRSPIWVGGGVTFAARPQDHSQKVNKKMYRGAVKSILSELVRQDRLIVVEKFSVEAP  129

Query  134  KTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMS  193
            KT+EL AKL +L+    LI+T+ +DENL+LAARNL  VDV D   IDPVSLIAFDKV+++
Sbjct  130  KTQELKAKLKELDLKDVLIITEELDENLFLAARNLYKVDVRDVQGIDPVSLIAFDKVLVT  189

Query  194  VAAAKKIEVEL  204
             AA KKIE  L
Sbjct  190  AAAVKKIEESL  200


> C4L7T1 50S ribosomal protein L4 [Tolumonas auensis (strain DSM 
9187 / TA4)]
Length=201

 Score =  274 bits (700),  Expect = 2e-96
 Identities = 142/188 (76%), Positives = 160/188 (85%), Gaps = 0/188 (0%)

Query  14   SAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRAR  73
            SA+++SE  FGREFNEALVHQVV AY AG RQGTRAQK+R+EVSGGGKKP+RQKGTGRAR
Sbjct  10   SALQVSETTFGREFNEALVHQVVVAYAAGARQGTRAQKTRSEVSGGGKKPWRQKGTGRAR  69

Query  74   AGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAP  133
            AG+IRSPIW GGG TFAA+PQD SQKVNRKMYRGA+Q IL+ELVRQDRLV+VE+F V AP
Sbjct  70   AGTIRSPIWRGGGVTFAAKPQDHSQKVNRKMYRGAIQSILSELVRQDRLVVVEKFGVDAP  129

Query  134  KTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMS  193
            KTKELL KL  L+    LIVT  V+ENL+LAARNL  VDV D T IDPVSLIAFDKV+M+
Sbjct  130  KTKELLTKLQALDLKDVLIVTPEVEENLFLAARNLYKVDVRDVTGIDPVSLIAFDKVLMT  189

Query  194  VAAAKKIE  201
              A K+IE
Sbjct  190  ADAVKQIE  197


> Q9KNY5 50S ribosomal protein L4 [Vibrio cholerae serotype O1 
(strain ATCC 39315 / El Tor Inaba N16961)]
Length=200

 Score =  266 bits (681),  Expect = 2e-93
 Identities = 137/196 (70%), Positives = 160/196 (82%), Gaps = 0/196 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            + L     +A+ +SE  FGREFNEALVHQVV AY AG RQGTRAQK+R+EVSGGG KP+R
Sbjct  1    MELMVKGANALTVSETTFGREFNEALVHQVVVAYAAGARQGTRAQKTRSEVSGGGAKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAG+IRSPIW  GG TFAA+PQD SQKVN+KMYRGAM+ IL+ELVRQ+RL++V
Sbjct  61   QKGTGRARAGTIRSPIWRTGGVTFAAKPQDHSQKVNKKMYRGAMKSILSELVRQERLIVV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            E F+V APKTK L+AKL +L     LIVT  VDENL+LAARNL  VDV D T IDPVSLI
Sbjct  121  ENFSVEAPKTKALVAKLKELELNDVLIVTGEVDENLFLAARNLYKVDVRDVTGIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIE  201
            AFDKV+M+ AA K++E
Sbjct  181  AFDKVLMTAAAVKQVE  196


> P44345 50S ribosomal protein L4 [Haemophilus influenzae (strain 
ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=200

 Score =  265 bits (676),  Expect = 9e-93
 Identities = 135/196 (69%), Positives = 161/196 (82%), Gaps = 0/196 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            + L+ V  +A+ +SE  FGREFNEAL+HQVV AY AG RQGTRAQK+RAEVSG GKKP+R
Sbjct  1    MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGTRAQKTRAEVSGSGKKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAG I+SPIW  GG TFAA+PQD SQKVN+KMYRGA++ IL+ELVRQDRLV+V
Sbjct  61   QKGTGRARAGDIKSPIWRSGGTTFAAKPQDHSQKVNKKMYRGAIKSILSELVRQDRLVVV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            E+F + APKTK L+ KL DL    ALI+T ++DENL+LAARNL  VDV D   IDPVSLI
Sbjct  121  EKFELDAPKTKVLVQKLKDLAVEDALIITASLDENLFLAARNLYKVDVRDVQGIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIE  201
            AFDKV+++V A K+IE
Sbjct  181  AFDKVIVTVDAVKQIE  196


> P60723 50S ribosomal protein L4 [Escherichia coli (strain K12)]
Length=201

 Score =  263 bits (673),  Expect = 3e-92
 Identities = 134/188 (71%), Positives = 157/188 (84%), Gaps = 0/188 (0%)

Query  14   SAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRAR  73
            SA+ +SE  FGR+FNEALVHQVV AY AG RQGTRAQK+RAEV+G GKKP+RQKGTGRAR
Sbjct  10   SALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRAR  69

Query  74   AGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAP  133
            +GSI+SPIW  GG TFAARPQD SQKVN+KMYRGA++ IL+ELVRQDRL++VE+F+V AP
Sbjct  70   SGSIKSPIWRSGGVTFAARPQDHSQKVNKKMYRGALKSILSELVRQDRLIVVEKFSVEAP  129

Query  134  KTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMS  193
            KTK L  KL D+     LI+T  +DENL+LAARNL  VDV DAT IDPVSLIAFDKVVM+
Sbjct  130  KTKLLAQKLKDMALEDVLIITGELDENLFLAARNLHKVDVRDATGIDPVSLIAFDKVVMT  189

Query  194  VAAAKKIE  201
              A K++E
Sbjct  190  ADAVKQVE  197


> P60726 50S ribosomal protein L4 [Salmonella typhimurium (strain 
LT2 / SGSC1412 / ATCC 700720)]
Length=201

 Score =  263 bits (673),  Expect = 3e-92
 Identities = 134/188 (71%), Positives = 157/188 (84%), Gaps = 0/188 (0%)

Query  14   SAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRAR  73
            SA+ +SE  FGR+FNEALVHQVV AY AG RQGTRAQK+RAEV+G GKKP+RQKGTGRAR
Sbjct  10   SALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRAR  69

Query  74   AGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAP  133
            +GSI+SPIW  GG TFAARPQD SQKVN+KMYRGA++ IL+ELVRQDRL++VE+F+V AP
Sbjct  70   SGSIKSPIWRSGGVTFAARPQDHSQKVNKKMYRGALKSILSELVRQDRLIVVEKFSVEAP  129

Query  134  KTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMS  193
            KTK L  KL D+     LI+T  +DENL+LAARNL  VDV DAT IDPVSLIAFDKVVM+
Sbjct  130  KTKLLAQKLKDMALEDVLIITGELDENLFLAARNLHKVDVRDATGIDPVSLIAFDKVVMT  189

Query  194  VAAAKKIE  201
              A K++E
Sbjct  190  ADAVKQVE  197


> Q9HWD6 50S ribosomal protein L4 [Pseudomonas aeruginosa (strain 
ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 
/ 1C / PRS 101 / PAO1)]
Length=200

 Score =  262 bits (669),  Expect = 1e-91
 Identities = 134/200 (67%), Positives = 159/200 (80%), Gaps = 0/200 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            + L      A+E+SE  FG EFNE LVHQ V AY+AGGRQG++AQK+R+EVSGGGKKP+R
Sbjct  1    MQLNVNGAQAIEVSERTFGGEFNETLVHQAVVAYMAGGRQGSKAQKTRSEVSGGGKKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRARAG+IRSPIW GGG TFAA+P+   QK+N+KMYR A++ ILAELVR DRLV+V
Sbjct  61   QKGTGRARAGTIRSPIWRGGGTTFAAKPRSHEQKLNKKMYRAALRSILAELVRLDRLVVV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
             +FAV APKTK L+AKL+ L     LIVTD VDENLYLAARNL HVDV D    DPVSLI
Sbjct  121  ADFAVDAPKTKGLVAKLDTLGLKDVLIVTDGVDENLYLAARNLAHVDVRDVQGSDPVSLI  180

Query  186  AFDKVVMSVAAAKKIEVELG  205
            A+DKV+++V+A KK E  LG
Sbjct  181  AYDKVLVTVSAVKKFEELLG  200


> P55836 50S ribosomal protein L4 [Aggregatibacter actinomycetemcomitans]
Length=200

 Score =  261 bits (666),  Expect = 3e-91
 Identities = 133/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)

Query  6    VNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFR  65
            + L+ V  +A+ +SE  FGREFNEAL+HQVV AY AG RQG+RAQK+RAEVSG GKKP+R
Sbjct  1    MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGSRAQKTRAEVSGSGKKPWR  60

Query  66   QKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLV  125
            QKGTGRAR+G IRSPIW  GG TFAA+PQD SQKVN+KMYRGA++ IL+ELVRQDRLV+V
Sbjct  61   QKGTGRARSGDIRSPIWRSGGVTFAAKPQDHSQKVNKKMYRGAIKSILSELVRQDRLVVV  120

Query  126  EEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLI  185
            ++F + APKTK L+ KL +L     LI+T ++DENL+LAARNL  VDV DA  IDPVSLI
Sbjct  121  DKFEIDAPKTKVLVQKLKELALEDVLIITASLDENLFLAARNLYKVDVRDAQGIDPVSLI  180

Query  186  AFDKVVMSVAAAKKIE  201
            AFDKVV++V A K+IE
Sbjct  181  AFDKVVVTVDAVKQIE  196


> P49226 50S ribosomal protein L4 [Morganella morganii]
Length=200

 Score =  259 bits (663),  Expect = 8e-91
 Identities = 132/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)

Query  15   AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARA  74
            ++ +SE  FGR+FNEALVHQVV AY AG RQGTRAQK+RAEV+G GKKP+RQKGTGRAR+
Sbjct  10   SLTVSETTFGRDFNEALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRARS  69

Query  75   GSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAPK  134
            GSI+SPIW  GG TFAA+PQD SQKVN+KMYRGA++ IL+ELVRQDRL++VE+FAV APK
Sbjct  70   GSIKSPIWRSGGITFAAKPQDHSQKVNKKMYRGALKSILSELVRQDRLIIVEKFAVEAPK  129

Query  135  TKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMSV  194
            TK L+ KL D+     +IVT  VDENL+LAARNL  VDV D TAIDPVSLIAF KVVM+ 
Sbjct  130  TKLLVQKLKDMALEDVMIVTHEVDENLFLAARNLYKVDVRDVTAIDPVSLIAFGKVVMTA  189

Query  195  AAAKKIE  201
             A K++E
Sbjct  190  EAVKQVE  196


> P60731 50S ribosomal protein L4 [Yersinia pseudotuberculosis 
serotype I (strain IP32953)]
Length=201

 Score =  258 bits (660),  Expect = 2e-90
 Identities = 131/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)

Query  15   AVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARA  74
            A+ +SE  FGR+FNEALVHQVV AY AG RQGTRAQK+RAEV+G GKKP+RQKGTGRARA
Sbjct  11   ALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRARA  70

Query  75   GSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAPK  134
            GS++SPIW  GG TFAA+PQD SQKVN+KMYRGA++ IL+ELVRQDRL++VE+F+V APK
Sbjct  71   GSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGALKSILSELVRQDRLIIVEKFSVEAPK  130

Query  135  TKELLAKLNDLNAARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMSV  194
            TK L  KL D+     LIVT  +DENL+LAARNL  VDV D   IDPVSLIAFDKVVM+ 
Sbjct  131  TKLLAQKLKDMALEDVLIVTGELDENLFLAARNLYKVDVRDVAGIDPVSLIAFDKVVMTA  190

Query  195  AAAKKIE  201
             A K++E
Sbjct  191  DAVKQVE  197


> P28601 50S ribosomal protein L4 [Geobacillus stearothermophilus]
Length=207

 Score =  168 bits (425),  Expect = 7e-55
 Identities = 91/198 (46%), Positives = 138/198 (70%), Gaps = 3/198 (2%)

Query  5    NVNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPF  64
            N N +TV    +EL++  FG E N+ ++ + V    A  RQGT   K+RAEVSGGG+KP+
Sbjct  8    NQNGQTVG--EIELNDAVFGIEPNKHVLFEAVIMQRASMRQGTHKTKNRAEVSGGGRKPW  65

Query  65   RQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVL  124
            RQKGTGRAR GSIR+P W GGG  F   P+ +S K+ +K+ R A++  L+  V ++ +V+
Sbjct  66   RQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLENDIVV  125

Query  125  VEEFAVAAPKTKELLAKLNDLNAAR-ALIVTDAVDENLYLAARNLPHVDVVDATAIDPVS  183
            +++ ++ APKTKE++  LN+L+  R ALIVTD ++EN+YL+ARN+P V VV A  I+ + 
Sbjct  126  LDQLSLEAPKTKEMVKILNNLSVDRKALIVTDELNENVYLSARNIPGVKVVPANGINVLD  185

Query  184  LIAFDKVVMSVAAAKKIE  201
            ++  DK+V++ AA +K+E
Sbjct  186  VLNHDKLVITKAAVEKVE  203


> P42921 50S ribosomal protein L4 [Bacillus subtilis (strain 168)]
Length=207

 Score =  148 bits (373),  Expect = 4e-47
 Identities = 79/187 (42%), Positives = 123/187 (66%), Gaps = 1/187 (1%)

Query  16   VELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARAG  75
            +EL+   FG E NE++V   +    A  RQGT   K+R+EV GGG+KP+RQKGTGRAR G
Sbjct  17   IELNASVFGIEPNESVVFDAILMQRASLRQGTHKVKNRSEVRGGGRKPWRQKGTGRARQG  76

Query  76   SIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDRLVLVEEFAVAAPKT  135
            SIRSP W GGG  F   P+ +S K+ +K+ R A++ +L+  V  + ++++E+  +   KT
Sbjct  77   SIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKT  136

Query  136  KELLAKLNDLNA-ARALIVTDAVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMSV  194
            KE+ A L  L+   +ALIVT   +E + L+ARN+P V VV+A  I+ + ++  +K++++ 
Sbjct  137  KEMAAILKGLSVEKKALIVTADANEAVALSARNIPGVTVVEANGINVLDVVNHEKLLITK  196

Query  195  AAAKKIE  201
            AA +K+E
Sbjct  197  AAVEKVE  203


> P0C0D5 50S ribosomal protein L4 [Streptococcus pyogenes]
Length=207

 Score =  145 bits (367),  Expect = 3e-46
 Identities = 85/201 (42%), Positives = 124/201 (62%), Gaps = 4/201 (2%)

Query  5    NVNLKTVSG---SAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGK  61
            NV L   +G   S+VEL++  FG E NE++V  VV +  A  RQGT A K+R+ VSGGG+
Sbjct  3    NVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGGGR  62

Query  62   KPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVRQDR  121
            KP+RQKGTGRAR GSIRSP W GGG  F   P+ +  K+ +K+ R A++ + +  V +D+
Sbjct  63   KPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSAKVAEDK  122

Query  122  LVLVEEFAVAAPKTKELLAKLNDLNA-ARALIVTDAVDENLYLAARNLPHVDVVDATAID  180
             V VE  + AAPKT E    L+ L+   + L++ +  +E   L+ARNLP+V V  A    
Sbjct  123  FVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFAALSARNLPNVTVATAATAS  182

Query  181  PVSLIAFDKVVMSVAAAKKIE  201
             + ++  DK++++  A   IE
Sbjct  183  VLDIVNADKLLVTKEAISTIE  203



Lambda      K        H        a         alpha
   0.320    0.134    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 653540


  Database: 6d7437082cb81688f955cab1c409f78d.SwissProt.fasta
    Posted date:  Sep 21, 2020  5:58 AM
  Number of letters in database: 5,035
  Number of sequences in database:  25



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40