ACIAD3236 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 1f5df84d1053fe355bbf0431b9fe9bb3.TrEMBL.fasta
           13 sequences; 2,747 total letters



Query= ACIAD3236

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F7P6 Putative DNA transformation protein (ComF) [Acinetobacte...   436    2e-160
  N9C473 Pribosyltran domain-containing protein [Acinetobacter ur...   272    1e-95 
  N9QVU7 Pribosyltran domain-containing protein [Acinetobacter ur...   272    2e-95 
  A0A2N6VED2 ComF family protein [Acinetobacter ursingii]              272    2e-95 
  A0A009Z775 Phosphoribosyl transferase domain protein [Acinetoba...   267    1e-93 
  A0A0M1I800 DNA transformation protein [Acinetobacter sp. C15]        266    4e-93 
  A0A1P8EK25 Amidophosphoribosyltransferase [Acinetobacter soli]       266    4e-93 
  A0A137Y2T9 DNA transformation protein [Acinetobacter venetianus]     265    6e-93 
  U7GTR4 Competence protein ComF [Acinetobacter sp. COS3]              263    3e-92 
  A0A150I0X2 Ribose-phosphate pyrophosphokinase [Acinetobacter ve...   263    4e-92 
  N9BXG1 Uncharacterized protein [Acinetobacter soli NIPH 2899]        262    1e-91 
  Q5D8D4 ComF [Haemophilus influenzae]                                78.6    3e-21 
  B0M0H5 ComF [Serratia sp. SES-01]                                   40.8    2e-08 


> Q6F7P6 Putative DNA transformation protein (ComF) [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=213

 Score =  436 bits (1122),  Expect = 2e-160
 Identities = 213/213 (100%), Positives = 213/213 (100%), Gaps = 0/213 (0%)

Query  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60
            MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA
Sbjct  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60

Query  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120
            CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL
Sbjct  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120

Query  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180
            LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD
Sbjct  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180

Query  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAAVFD  213
            VVTTGSSIHALTHVLQNLGCVHIYPVCIAAVFD
Sbjct  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAAVFD  213


> N9C473 Pribosyltran domain-containing protein [Acinetobacter 
ursingii ANC 3649]
Length=217

 Score =  272 bits (696),  Expect = 1e-95
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 0/210 (0%)

Query  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60
            M M + +  ++Q L ++ +PC LCE SP+ KQ +LCK CWQ+LPW K  + RHEL I+AA
Sbjct  1    MPMFDNIKASMQQLGQKLLPCRLCESSPRLKQYVLCKSCWQQLPWLKQPIHRHELQIMAA  60

Query  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120
            C Y YPID+I+QQFKY  +LH+Q LL  LL  +  P+VQAIVPMPISE RLIERGYNQSL
Sbjct  61   CYYDYPIDRILQQFKYEQKLHHQPLLDQLLAQMKYPKVQAIVPMPISEARLIERGYNQSL  120

Query  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180
            LLAQ +AK LN+PVWQP+ RL QHSQKGL+R+ERI  I++QF++ +  + RYR+V+I+DD
Sbjct  121  LLAQQLAKKLNIPVWQPIHRLEQHSQKGLNRIERIQGIEQQFVLLEKPQIRYRKVLIIDD  180

Query  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAA  210
            VVTTGSSI+AL   LQ LGC  IY  CIAA
Sbjct  181  VVTTGSSIYALHQALQQLGCQQIYACCIAA  210


> N9QVU7 Pribosyltran domain-containing protein [Acinetobacter 
ursingii NIPH 706]
Length=218

 Score =  272 bits (695),  Expect = 2e-95
 Identities = 130/210 (62%), Positives = 161/210 (77%), Gaps = 0/210 (0%)

Query  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60
            M M + +  ++Q L ++ +PC LCE SP+ K  +LCK CWQ+LPW K  + RHEL I+AA
Sbjct  1    MPMFDNIKASMQQLGQKLLPCRLCESSPRLKHYVLCKSCWQQLPWLKQPIHRHELQIMAA  60

Query  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120
            C Y YPID+I+QQFKY  +LH+Q LL  LL  +  P+VQAIVPMPIS+ RLIERGYNQSL
Sbjct  61   CYYHYPIDRILQQFKYEQKLHHQPLLDQLLAQVRHPKVQAIVPMPISDARLIERGYNQSL  120

Query  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180
            LLAQ +AK LNVP+WQP+ RL QHSQKGL+RLERI  I++QF+V +  K RYR+V+I+DD
Sbjct  121  LLAQQLAKKLNVPIWQPIHRLEQHSQKGLNRLERIQGIEQQFVVLEKPKIRYRKVLIIDD  180

Query  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAA  210
            VVTTGSSI+AL   LQ LGC  IY  CIAA
Sbjct  181  VVTTGSSIYALHQALQQLGCQQIYACCIAA  210


> A0A2N6VED2 ComF family protein [Acinetobacter ursingii]
Length=218

 Score =  272 bits (695),  Expect = 2e-95
 Identities = 130/210 (62%), Positives = 161/210 (77%), Gaps = 0/210 (0%)

Query  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60
            M M + +  ++Q L ++ +PC LCE SP+ K  +LCK CWQ+LPW K  + RHEL I+AA
Sbjct  1    MPMFDNIKASMQQLGQKLLPCRLCESSPRLKHYVLCKSCWQQLPWLKQPIHRHELQIMAA  60

Query  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120
            C Y YPID+I+QQFKY  +LH+Q LL  LL  +  P+VQAIVPMPIS+ RLIERGYNQSL
Sbjct  61   CYYHYPIDRILQQFKYEQKLHHQPLLDQLLAQVRHPKVQAIVPMPISDARLIERGYNQSL  120

Query  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180
            LLAQ +AK LNVP+WQP+ RL QHSQKGL+RLERI  I++QF+V +  K RYR+V+I+DD
Sbjct  121  LLAQQLAKKLNVPIWQPIHRLEQHSQKGLNRLERIQGIEQQFVVLEKPKIRYRKVLIIDD  180

Query  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAA  210
            VVTTGSSI+AL   LQ LGC  IY  CIAA
Sbjct  181  VVTTGSSIYALHQALQQLGCQQIYACCIAA  210


> A0A009Z775 Phosphoribosyl transferase domain protein [Acinetobacter 
sp. 479375]
Length=216

 Score =  267 bits (682),  Expect = 1e-93
 Identities = 125/204 (61%), Positives = 158/204 (77%), Gaps = 0/204 (0%)

Query  7    LATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYP  66
            +  ++Q L ++ +PC LC+ SP+ K  +LCK CWQ+LPW K  + RHEL I+AAC Y YP
Sbjct  5    IKASMQQLGQKLLPCRLCKSSPRLKHYVLCKSCWQQLPWLKQPIHRHELQIMAACYYDYP  64

Query  67   IDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSI  126
            ID+I+QQFKY  +LH+Q LL  LL  +  P+VQAIVPMPISE RLIERGYNQSLLLAQ +
Sbjct  65   IDRILQQFKYEQKLHHQPLLDQLLAQMKYPKVQAIVPMPISEARLIERGYNQSLLLAQQL  124

Query  127  AKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGS  186
            AK LN+PVWQP+ RL QHSQKGL+R+ERI  I++QF++ +  + RYR+V+I+DDVVTTGS
Sbjct  125  AKKLNLPVWQPIHRLEQHSQKGLNRIERIQGIEQQFVLLEKPQIRYRKVLIIDDVVTTGS  184

Query  187  SIHALTHVLQNLGCVHIYPVCIAA  210
            SI+AL   LQ LGC  IY  CIAA
Sbjct  185  SIYALHQALQQLGCQQIYACCIAA  208


> A0A0M1I800 DNA transformation protein [Acinetobacter sp. C15]
Length=218

 Score =  266 bits (679),  Expect = 4e-93
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 0/190 (0%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CPLC  S      ++C DCWQ+LPW  D V RHELNI AACEY  PI+QIVQQFKYH++L
Sbjct  21   CPLCGHSAAHSPYVICTDCWQDLPWLNDSVLRHELNIQAACEYADPINQIVQQFKYHEKL  80

Query  81   HYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNVPVWQPVER  140
            H+Q LL+ L+L LPLPRVQAIVPMPIS  RL ERGYNQ++L+A+ +AK LN+P+WQPV R
Sbjct  81   HHQRLLTQLILQLPLPRVQAIVPMPISTARLCERGYNQAMLIAEGVAKQLNLPIWQPVLR  140

Query  141  LAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIHALTHVLQNLGC  200
             A+H+QKGLSRLERI+ I++QF+    V+ R+RRVMI+DDVVTTGSSI+AL+  L  LGC
Sbjct  141  RAEHTQKGLSRLERIAGIEQQFVPDLRVRTRFRRVMIIDDVVTTGSSIYALSQALTTLGC  200

Query  201  VHIYPVCIAA  210
              IYP+C+AA
Sbjct  201  QRIYPICVAA  210


> A0A1P8EK25 Amidophosphoribosyltransferase [Acinetobacter soli]
Length=218

 Score =  266 bits (679),  Expect = 4e-93
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 0/190 (0%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CPLC  S      ++C DCWQ+LPW  D V RHELNI AACEY  PI+QIVQQFKYH++L
Sbjct  21   CPLCGHSAAHSPYVICTDCWQDLPWLNDSVLRHELNIQAACEYADPINQIVQQFKYHEKL  80

Query  81   HYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNVPVWQPVER  140
            H+Q LL+ L+L LPLPRVQAIVPMPIS  RL ERGYNQ++L+A+ +AK LN+P+WQPV R
Sbjct  81   HHQRLLTQLILQLPLPRVQAIVPMPISTARLCERGYNQAMLIAEGVAKQLNLPIWQPVLR  140

Query  141  LAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIHALTHVLQNLGC  200
             A+H+QKGLSRLERI+ I++QF+    V+ R+RRVMI+DDVVTTGSSI+AL+  L  LGC
Sbjct  141  RAEHTQKGLSRLERIAGIEQQFVPDLRVRTRFRRVMIIDDVVTTGSSIYALSQALTTLGC  200

Query  201  VHIYPVCIAA  210
              IYP+C+AA
Sbjct  201  QRIYPICVAA  210


> A0A137Y2T9 DNA transformation protein [Acinetobacter venetianus]
Length=216

 Score =  265 bits (678),  Expect = 6e-93
 Identities = 127/210 (60%), Positives = 161/210 (77%), Gaps = 1/210 (0%)

Query  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60
            M M NLL    + L     PC LC++  +Q+  + C +CWQ+LPW K  + RHE +I  A
Sbjct  1    MPMFNLLRKQTRQLFDYFTPCDLCDVGIKQQFGV-CSNCWQQLPWLKQQIQRHEQHIYVA  59

Query  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120
            C Y+YPID+I+QQFKY  +L Y+ LL+ LLL L LP++QAIVPMPIS  RLIERGYNQSL
Sbjct  60   CHYQYPIDRIIQQFKYEQKLEYERLLAGLLLQLKLPKIQAIVPMPISTDRLIERGYNQSL  119

Query  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180
            LLA+++++HLNVP+WQPV+RLAQHSQKGL+RLER+  I++QFI   P K RYR VMIVDD
Sbjct  120  LLAKTLSQHLNVPIWQPVQRLAQHSQKGLTRLERLDHIEQQFIACPPNKIRYRNVMIVDD  179

Query  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAA  210
            VVTTGSSIHAL+ +L+ LGC  IY +C+AA
Sbjct  180  VVTTGSSIHALSEILKQLGCQKIYAICLAA  209


> U7GTR4 Competence protein ComF [Acinetobacter sp. COS3]
Length=216

 Score =  263 bits (673),  Expect = 3e-92
 Identities = 127/210 (60%), Positives = 160/210 (76%), Gaps = 1/210 (0%)

Query  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60
            M M NLL    + L     PC LC++  +Q+  + C +CWQ+LPW K  + RHE +I  A
Sbjct  1    MPMFNLLRKQTRQLFDYFTPCDLCDVGIKQQFGV-CSNCWQQLPWLKQQIQRHEQHIYVA  59

Query  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120
            C Y+YPID+I+QQFKY  +L Y+ LL+ LLL L LP++QAIVPMPIS  RLIERGYNQSL
Sbjct  60   CHYQYPIDRIIQQFKYEQKLEYERLLAGLLLQLKLPKIQAIVPMPISIDRLIERGYNQSL  119

Query  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180
            LLA++++ HLNVP+WQPV+RLAQHSQKGL+RLER+  I++QFI   P K RYR VMIVDD
Sbjct  120  LLAKTLSLHLNVPIWQPVQRLAQHSQKGLTRLERLDHIEQQFIACPPNKIRYRNVMIVDD  179

Query  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAA  210
            VVTTGSSIHAL+ +L+ LGC  IY +C+AA
Sbjct  180  VVTTGSSIHALSEILKQLGCQKIYAICLAA  209


> A0A150I0X2 Ribose-phosphate pyrophosphokinase [Acinetobacter 
venetianus]
Length=216

 Score =  263 bits (672),  Expect = 4e-92
 Identities = 126/210 (60%), Positives = 161/210 (77%), Gaps = 1/210 (0%)

Query  1    MLMSNLLATTLQWLKKECVPCPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAA  60
            M M NLL    + L     PC LC++  +Q+  + C +CWQ+LPW K  + RHE +I  A
Sbjct  1    MPMFNLLRKQTRQLFDYFTPCDLCDVGIKQQFGV-CSNCWQQLPWLKQQIQRHEQHIYVA  59

Query  61   CEYRYPIDQIVQQFKYHDRLHYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSL  120
            C Y+YPID+I+QQFKY  +L Y+ LL+ LLL L LP++QAIVPMPIS  RLIERGYNQSL
Sbjct  60   CHYQYPIDRIIQQFKYEQKLEYERLLAGLLLQLKLPKIQAIVPMPISTDRLIERGYNQSL  119

Query  121  LLAQSIAKHLNVPVWQPVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDD  180
            LLA++++++LNVP+WQPV+RLAQHSQKGL+RLER+  I++QFI   P K RYR VMIVDD
Sbjct  120  LLAKTLSQYLNVPIWQPVQRLAQHSQKGLTRLERLDHIEQQFIACPPNKIRYRNVMIVDD  179

Query  181  VVTTGSSIHALTHVLQNLGCVHIYPVCIAA  210
            VVTTGSSIHAL+ +L+ LGC  IY +C+AA
Sbjct  180  VVTTGSSIHALSEILKQLGCQKIYAICLAA  209


> N9BXG1 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=218

 Score =  262 bits (670),  Expect = 1e-91
 Identities = 122/190 (64%), Positives = 151/190 (79%), Gaps = 0/190 (0%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CPLC  S      ++C DCWQ+LPW  D V RHEL I AACEY  PI+QIVQQFKYH++L
Sbjct  21   CPLCGHSAAHSPYVICTDCWQDLPWLNDSVLRHELIIQAACEYADPINQIVQQFKYHEKL  80

Query  81   HYQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNVPVWQPVER  140
            H+Q LL+ L+L LPLPRVQAIVPMPIS  RL ERGYNQ++L+A+ +AK LN+P+WQPV R
Sbjct  81   HHQRLLTQLILQLPLPRVQAIVPMPISTARLCERGYNQAMLIAEGVAKQLNLPIWQPVLR  140

Query  141  LAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIHALTHVLQNLGC  200
             A+H+QKGLSRLERI+ I++QF+    V+ R+RRVMI+DDVVTTGSSI+AL+  L  LGC
Sbjct  141  RAEHTQKGLSRLERIAGIEQQFVPDLRVRTRFRRVMIIDDVVTTGSSIYALSQALTTLGC  200

Query  201  VHIYPVCIAA  210
              IYP+C+AA
Sbjct  201  QRIYPICVAA  210


> Q5D8D4 ComF [Haemophilus influenzae]
Length=228

 Score = 78.6 bits (192),  Expect = 3e-21
 Identities = 53/180 (29%), Positives = 95/180 (53%), Gaps = 21/180 (12%)

Query  36   CKDCWQELP-WFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRLHYQSLLSSLLL---  91
            C +C ++ P W K  +  H         Y  P+  ++ +FK+ ++      L+ LL    
Sbjct  50   CGNCLKQEPSWDKMVIIGH---------YIEPLSILIHRFKFQNQFWIDRTLARLLYLAV  100

Query  92   -----TLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNVPVWQPVERLAQHS-  145
                 T  L   +AI+P+P+   R   RGYNQ+ LL++ +++ L++P    + +  +H+ 
Sbjct  101  RDAKRTHQLKLPEAIIPVPLYHFRQWRRGYNQADLLSRQLSRWLDIPNLSNIVKRVKHTY  160

Query  146  -QKGLSRLERISQIDEQF-IVRQPVKERYRRVMIVDDVVTTGSSIHALTHVLQNLGCVHI  203
             Q+GLS  +R   +   F +V    +  YRRV +VDDV+TTGS+++ ++ +L+ LG   I
Sbjct  161  TQRGLSAKDRRQNLKNAFSLVVSKNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEI  220


> B0M0H5 ComF [Serratia sp. SES-01]
Length=135

 Score = 40.8 bits (94),  Expect = 2e-08
 Identities = 31/107 (29%), Positives = 49/107 (46%), Gaps = 17/107 (16%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CP C L P    ++ C  C Q+ P ++  V  ++        Y  P+ Q++++FK+    
Sbjct  37   CPRCGL-PAGDARLPCGRCLQQPPPWQALVFVND--------YAAPLRQLIKKFKFQHTP  87

Query  81   HYQSLLSSLLLT--------LPLPRVQAIVPMPISEKRLIERGYNQS  119
                LL+ L+L           L R   I+ +P+  KR   RGYNQS
Sbjct  88   ELAPLLARLILLNWQQAHREQYLNRPDIILAVPLQAKRCWRRGYNQS  134



Lambda      K        H        a         alpha
   0.328    0.139    0.440    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 396528


  Database: 1f5df84d1053fe355bbf0431b9fe9bb3.TrEMBL.fasta
    Posted date:  Sep 19, 2020  1:37 PM
  Number of letters in database: 2,747
  Number of sequences in database:  13



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40