ACIAD3236 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 1a2c6ba0a8479119b658f9b75d38087f.SwissProt.fasta
           11 sequences; 2,372 total letters



Query= ACIAD3236

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P31773 Competence protein F [Haemophilus influenzae (strain ATC...  82.4    1e-22
  P46846 DNA utilization protein YhgH [Escherichia coli (strain K...  71.6    6e-19
  Q83J92 DNA utilization protein YhgH [Shigella flexneri]             71.2    8e-19
  Q8FCT3 DNA utilization protein YhgH [Escherichia coli O6:H1 (st...  70.9    1e-18
  Q8X715 DNA utilization protein YhgH [Escherichia coli O157:H7]      70.5    1e-18
  Q8Z222 DNA utilization protein YhgH [Salmonella typhi]              67.4    2e-17
  Q8ZLI8 DNA utilization protein YhgH [Salmonella typhimurium (st...  64.7    2e-16
  P39147 ComF operon protein 3 [Bacillus subtilis (strain 168)]       53.9    1e-12
  A5EVW7 Adenine phosphoribosyltransferase [Dichelobacter nodosus...  38.1    3e-07
  Q8TSS8 Hypoxanthine/guanine phosphoribosyltransferase [Methanos...  35.0    3e-06
  C7P0W1 HGPRTase-like protein [Halomicrobium mukohataei (strain ...  34.3    6e-06


> P31773 Competence protein F [Haemophilus influenzae (strain ATCC 
51907 / DSM 11121 / KW20 / Rd)]
Length=229

 Score = 82.4 bits (202),  Expect = 1e-22
 Identities = 55/180 (31%), Positives = 95/180 (53%), Gaps = 21/180 (12%)

Query  36   CKDCWQELP-WFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRLHYQSLLSSLLL---  91
            C +C ++ P W K  +  H         Y  P+  ++Q+FK+ ++      L+ LL    
Sbjct  51   CGNCLKQEPSWDKMVIIGH---------YIEPLSILIQRFKFQNQFWIDRTLARLLYLAV  101

Query  92   -----TLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNVPVWQPVERLAQH--  144
                 T  L   +AI+P+P+   R   RGYNQ+ LL+Q +++ L++P    + +  +H  
Sbjct  102  RDAKRTHQLKLPEAIIPVPLYHFRQWRRGYNQADLLSQQLSRWLDIPNLNNIVKRVKHTY  161

Query  145  SQKGLSRLERISQIDEQFIVRQPVKE-RYRRVMIVDDVVTTGSSIHALTHVLQNLGCVHI  203
            +Q+GLS  +R   +   F +     E  YRRV +VDDV+TTGS+++ ++ +L+ LG   I
Sbjct  162  TQRGLSAKDRRQNLKNAFSLAVSKNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEI  221


> P46846 DNA utilization protein YhgH [Escherichia coli (strain 
K12)]
Length=227

 Score = 71.6 bits (174),  Expect = 6e-19
 Identities = 62/199 (31%), Positives = 94/199 (47%), Gaps = 23/199 (12%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CP C L P     + C  C Q+ P ++  VT          +Y  P+  ++ Q K+  R 
Sbjct  37   CPQCGL-PATHSHLPCGRCLQKPPPWQRLVT--------VADYAPPLSPLIHQLKFSRRS  87

Query  81   HYQSLLSSLLL--------TLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNV  132
               S LS LLL        T  L     IV +P+ ++R   RG+NQS LL Q +++ L+ 
Sbjct  88   EIASALSRLLLLEVLHARRTTGLQLPDRIVSVPLWQRRHWRRGFNQSDLLCQPLSRWLHC  147

Query  133  PVW--QPVERL-AQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIH  189
              W  + V R  A  +Q  LS   R   +   F +  PV+ R+  ++IVDDVVTTGS++ 
Sbjct  148  Q-WDSEAVTRTRATATQHFLSARLRKRNLKNAFRLELPVQGRH--MVIVDDVVTTGSTVA  204

Query  190  ALTHVLQNLGCVHIYPVCI  208
             +  +L   G   +   C+
Sbjct  205  EIAQLLLRNGAAAVQVWCL  223


> Q83J92 DNA utilization protein YhgH [Shigella flexneri]
Length=227

 Score = 71.2 bits (173),  Expect = 8e-19
 Identities = 61/199 (31%), Positives = 94/199 (47%), Gaps = 23/199 (12%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CP C L P     + C  C Q+ P ++  VT          +Y  P+  ++ Q K+  R 
Sbjct  37   CPQCGL-PATHSHLPCGRCLQKPPPWQRLVT--------VADYAPPLSPLIHQLKFSRRS  87

Query  81   HYQSLLSSLLL--------TLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNV  132
               S LS LLL        T  L     I+ +P+ ++R   RG+NQS LL Q +++ L+ 
Sbjct  88   EIASALSRLLLLEVLHARRTTGLQLPDRIISVPLWQRRHWRRGFNQSDLLCQPLSRWLHC  147

Query  133  PVW--QPVERL-AQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIH  189
              W  + V R  A  +Q  LS   R   +   F +  PV+ R+  ++IVDDVVTTGS++ 
Sbjct  148  Q-WDSEAVTRTRATATQHFLSARLRKRNLKNAFRLELPVQGRH--MVIVDDVVTTGSTVA  204

Query  190  ALTHVLQNLGCVHIYPVCI  208
             +  +L   G   +   C+
Sbjct  205  EIAQLLLRNGAATVQVWCL  223


> Q8FCT3 DNA utilization protein YhgH [Escherichia coli O6:H1 (strain 
CFT073 / ATCC 700928 / UPEC)]
Length=227

 Score = 70.9 bits (172),  Expect = 1e-18
 Identities = 61/199 (31%), Positives = 94/199 (47%), Gaps = 23/199 (12%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CP C L P     + C  C Q+ P ++  VT          +Y  P+  ++ Q K+  R 
Sbjct  37   CPQCGL-PATHSHLPCGRCLQKPPPWQRLVT--------VADYAPPLSPLIHQLKFSRRS  87

Query  81   HYQSLLSSLLL--------TLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNV  132
               S LS LLL        T  L     I+ +P+ ++R   RG+NQS LL Q +++ L+ 
Sbjct  88   EIASALSRLLLLEVLHARRTTGLQLPDRIISVPLWQRRHWRRGFNQSDLLCQPLSRWLHC  147

Query  133  PVW--QPVERL-AQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIH  189
              W  + V R  A  +Q  LS   R   +   F +  PV+ R+  ++IVDDVVTTGS++ 
Sbjct  148  R-WDSEAVTRTRATATQHFLSARLRKRNLKNAFRLELPVQGRH--MVIVDDVVTTGSTVA  204

Query  190  ALTHVLQNLGCVHIYPVCI  208
             +  +L   G   +   C+
Sbjct  205  EIAQLLLRNGAATVQVWCL  223


> Q8X715 DNA utilization protein YhgH [Escherichia coli O157:H7]
Length=227

 Score = 70.5 bits (171),  Expect = 1e-18
 Identities = 59/199 (30%), Positives = 91/199 (46%), Gaps = 23/199 (12%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CP C L P     + C  C Q+ P ++  VT          +Y  P+  ++ Q K+  R 
Sbjct  37   CPQCGL-PATHSHLPCGRCLQKPPPWQRLVT--------VADYAPPLSLLIHQLKFSRRS  87

Query  81   HYQSLLSSLLL--------TLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNV  132
               S LS LLL        T  L     I+ +P+ ++R   RG+NQS LL Q +++ L+ 
Sbjct  88   EIASALSRLLLLEVLHARRTTGLQLPDRIISVPLWQRRHWRRGFNQSDLLCQPLSRWLHC  147

Query  133  PVWQP---VERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIH  189
              W         A  +Q  LS   R   +   F +  PV+ R+  ++IVDDVVTTGS++ 
Sbjct  148  Q-WDSEAITRTRATATQHFLSARLRRRNLKNAFRLELPVQGRH--MVIVDDVVTTGSTVA  204

Query  190  ALTHVLQNLGCVHIYPVCI  208
             +  +L   G   +   C+
Sbjct  205  EIAQLLLRNGAATVQVWCL  223


> Q8Z222 DNA utilization protein YhgH [Salmonella typhi]
Length=227

 Score = 67.4 bits (163),  Expect = 2e-17
 Identities = 61/201 (30%), Positives = 94/201 (47%), Gaps = 27/201 (13%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CP C L P     + C  C Q+ P ++         +++  +Y  P+  +V Q K+  R 
Sbjct  37   CPQCGL-PAGHPSLPCGRCLQKPPPWQ--------RLVSVSDYTPPLSLLVHQLKFTRRS  87

Query  81   HYQSLLSSLLLT----------LPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHL  130
               + L+ LLL           LPLP    IV +P+  +R   RG+NQS LL Q +A  L
Sbjct  88   EIAAALARLLLQEVLMARRSTGLPLP--DRIVSVPLWSRRHWRRGFNQSDLLCQPLAHWL  145

Query  131  NVPVW--QPVERL-AQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSS  187
                W  Q + R+ A  +Q  LS   R   +   F +  PV+  +  ++IVDDVVTTGS+
Sbjct  146  GC-AWDSQTITRVRATATQHHLSARLRKRNLKNAFRLELPVQGLH--MVIVDDVVTTGST  202

Query  188  IHALTHVLQNLGCVHIYPVCI  208
            +  +  +L   G   +   C+
Sbjct  203  VAEIAQLLLRNGAATVQVWCL  223


> Q8ZLI8 DNA utilization protein YhgH [Salmonella typhimurium (strain 
LT2 / SGSC1412 / ATCC 700720)]
Length=227

 Score = 64.7 bits (156),  Expect = 2e-16
 Identities = 60/201 (30%), Positives = 93/201 (46%), Gaps = 27/201 (13%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CP C L P     + C  C Q+ P ++         +++  +Y  P+  +V Q K+  R 
Sbjct  37   CPQCGL-PAAHPSLPCGRCLQKPPPWQ--------RLVSVSDYTPPLSLLVHQLKFTRRS  87

Query  81   HYQSLLSSLLLT----------LPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHL  130
               + L+ LLL           L LP    IV +P+  +R   RG+NQS LL Q +A  L
Sbjct  88   EIAAALARLLLQEVLMARRSTGLQLP--DRIVSVPLWSRRHWRRGFNQSDLLCQPLAHWL  145

Query  131  NVPVW--QPVERL-AQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSS  187
                W  Q + R+ A  +Q  LS   R   +   F +  PV+  +  ++IVDDVVTTGS+
Sbjct  146  GC-AWDSQTITRVRATATQHHLSARLRKRNLKNAFRLELPVQGLH--MVIVDDVVTTGST  202

Query  188  IHALTHVLQNLGCVHIYPVCI  208
            +  +  +L   G   +   C+
Sbjct  203  VAEIAQLLLRNGAATVQVWCL  223


> P39147 ComF operon protein 3 [Bacillus subtilis (strain 168)]
Length=229

 Score = 53.9 bits (128),  Expect = 1e-12
 Identities = 45/183 (25%), Positives = 82/183 (45%), Gaps = 14/183 (8%)

Query  21   CPLCELSPQQKQQILCKDCWQELPWFKDYVTRHELNILAACEYRYPIDQIVQQFKYHDRL  80
            CPLC     Q    +C+DC       +D +   +    +   Y   + + + +FK+    
Sbjct  44   CPLC--GRPQSVHAVCRDCEVWRTRIRDSLLLRQNR--SVYTYNDMMKETLSRFKFRGDA  99

Query  81   H----YQSLLSSLLLTLPLPRVQAIVPMPISEKRLIERGYNQSLLLAQSIAKHLNVPVWQ  136
                 ++S  SS    +   +   +VP+P+S++R  ERG+NQ+ LLA+     L+ P   
Sbjct  100  EIINAFKSDFSSTFSKVYPDKHFVLVPIPLSKEREEERGFNQAHLLAEC----LDRPSHH  155

Query  137  PVERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIHALTHVLQ  196
            P+ RL    Q    + ER+  + E     +        ++++DD+ TTG+++H     L 
Sbjct  156  PLIRLNNEKQSKKKKTERL--LSECIFDTKNNSAEGMNIILIDDLYTTGATLHFAARCLL  213

Query  197  NLG  199
              G
Sbjct  214  EKG  216


> A5EVW7 Adenine phosphoribosyltransferase [Dichelobacter nodosus 
(strain VCS1703A)]
Length=174

 Score = 38.1 bits (87),  Expect = 3e-07
 Identities = 26/87 (30%), Positives = 47/87 (54%), Gaps = 11/87 (13%)

Query  118  QSLLLAQSIAKHLNV---PVWQP--VERLAQHSQKGLSRLERISQIDEQFIVRQPVKERY  172
            +  + A ++A  L +   P+ +P  + R   H   GL   E   ++ +Q I      ++ 
Sbjct  62   RGFIFAAALAHRLGIGFIPLRKPHKLPREVAHINYGLEYGEDCLEVHKQDI------KKG  115

Query  173  RRVMIVDDVVTTGSSIHALTHVLQNLG  199
             R+M+VDDV+ TG ++HA  ++LQ+LG
Sbjct  116  MRIMMVDDVLATGGTMHACMNLLQSLG  142


> Q8TSS8 Hypoxanthine/guanine phosphoribosyltransferase [Methanosarcina 
acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 
/ C2A)]
Length=189

 Score = 35.0 bits (79),  Expect = 3e-06
 Identities = 15/26 (58%), Positives = 21/26 (81%), Gaps = 0/26 (0%)

Query  174  RVMIVDDVVTTGSSIHALTHVLQNLG  199
            RV+IVDDV++TG ++ AL   LQN+G
Sbjct  116  RVVIVDDVISTGGTLLALVKALQNMG  141


> C7P0W1 HGPRTase-like protein [Halomicrobium mukohataei (strain 
ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541)]
Length=189

 Score = 34.3 bits (77),  Expect = 6e-06
 Identities = 22/71 (31%), Positives = 38/71 (54%), Gaps = 1/71 (1%)

Query  138  VERLAQHSQKGLSRLERISQIDEQFIVRQPVKERYRRVMIVDDVVTTGSSIHALTHVLQN  197
            V R  Q+   G   L +++   E  +    V E   RV+++DDV++TG ++ ALT  L++
Sbjct  81   VVRKRQYGLDGEVSLSQVTGYSENEMYVNDVYEG-DRVLVLDDVLSTGGTLAALTGALED  139

Query  198  LGCVHIYPVCI  208
            +G      VC+
Sbjct  140  IGADICDIVCV  150



Lambda      K        H        a         alpha
   0.328    0.139    0.440    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 347805


  Database: 1a2c6ba0a8479119b658f9b75d38087f.SwissProt.fasta
    Posted date:  Sep 26, 2020  8:09 PM
  Number of letters in database: 2,372
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40