ACIAD3296 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: b0caaa9bae5f5d673f6f3a649587f8c1.TrEMBL.fasta
           15 sequences; 1,561 total letters



Query= ACIAD3296

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F7J5 ABM domain-containing protein [Acinetobacter baylyi (str...   211    4e-75
  A0A0M1I9M4 Antibiotic biosynthesis monooxygenase [Acinetobacter...   135    1e-45
  A0A1P8EK67 Antibiotic biosynthesis monooxygenase [Acinetobacter...   133    1e-44
  N9N4A9 ABM domain-containing protein [Acinetobacter sp. NIPH 298]    132    3e-44
  N9C0T8 ABM domain-containing protein [Acinetobacter soli NIPH 2...   132    4e-44
  N8PRR8 ABM domain-containing protein [Acinetobacter sp. CIP-A165]    131    6e-44
  N9FIN6 ABM domain-containing protein [Acinetobacter haemolyticu...   130    2e-43
  A0A014EZZ9 Putative quinol monooxygenase ygiN [Acinetobacter sp...   128    1e-42
  A0A014D5C9 Putative quinol monooxygenase ygiN [Acinetobacter sp...   128    1e-42
  A0A014CWZ3 Putative quinol monooxygenase ygiN [Acinetobacter sp...   128    1e-42
  A0A140QU15 Putative quinol monooxygenase ygiN [Acinetobacter sp...   128    1e-42
  A0A062L1C5 Putative quinol monooxygenase ygiN [Acinetobacter ba...   127    2e-42
  A0A0E2GE00 ABM domain-containing protein [Acinetobacter nosocom...   127    2e-42
  A0A2T7FK22 Antibiotic biosynthesis monooxygenase [Acinetobacter...   127    2e-42
  A0A2P8VGY2 Antibiotic biosynthesis monooxygenase [Siccibacter t...   127    4e-42


> Q6F7J5 ABM domain-containing protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=105

 Score =  211 bits (536),  Expect = 4e-75
 Identities = 105/105 (100%), Positives = 105/105 (100%), Gaps = 0/105 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI
Sbjct  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQDTTA  105
            MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQDTTA
Sbjct  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQDTTA  105


> A0A0M1I9M4 Antibiotic biosynthesis monooxygenase [Acinetobacter 
sp. C15]
Length=104

 Score =  135 bits (341),  Expect = 1e-45
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 0/100 (0%)

Query  1   MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
           MITVIAEI+TH GAEHR+ VLA+   I  +VLAE GC+ YQP+ID  +E SFQR D  SI
Sbjct  1   MITVIAEIKTHAGAEHREAVLAALHSIRTEVLAEDGCHGYQPMIDHASEVSFQRHDAQSI  60

Query  61  MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRIL  100
           +M E WESVAHL+AHLQTAHM A+Q RVK HV  VDIRIL
Sbjct  61  VMLEHWESVAHLEAHLQTAHMQAYQARVKAHVIEVDIRIL  100


> A0A1P8EK67 Antibiotic biosynthesis monooxygenase [Acinetobacter 
soli]
Length=104

 Score =  133 bits (335),  Expect = 1e-44
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 0/100 (0%)

Query  1   MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
           MITVIAEI+TH GA HR+ VLA+   I  +VLAE GC+ YQP+ID  +E SFQR D  SI
Sbjct  1   MITVIAEIKTHAGAAHREAVLAALHSIRTEVLAEDGCHGYQPMIDHASEVSFQRHDAQSI  60

Query  61  MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRIL  100
           +M E WESVAHL+AHLQTAHM A+Q RVK HV  VDIRIL
Sbjct  61  VMLEHWESVAHLEAHLQTAHMQAYQARVKAHVIEVDIRIL  100


> N9N4A9 ABM domain-containing protein [Acinetobacter sp. NIPH 
298]
Length=104

 Score =  132 bits (332),  Expect = 3e-44
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRTH G EHRQ VLA+FE+I+P VLAE GC+ Y PLID       Q  D +SI
Sbjct  1    MLTIIAEIRTHQGTEHRQAVLAAFEKIIPTVLAEDGCHGYAPLIDHLPAIGMQTQDENSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M EQWES AHL+AH+QTAHML H E  KDHVA V +RIL+
Sbjct  61   VMLEQWESTAHLEAHMQTAHMLKHFEATKDHVADVKVRILE  101


> N9C0T8 ABM domain-containing protein [Acinetobacter soli NIPH 
2899]
Length=104

 Score =  132 bits (331),  Expect = 4e-44
 Identities = 66/100 (66%), Positives = 76/100 (76%), Gaps = 0/100 (0%)

Query  1   MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
           MITVIAEI+TH G EHR+ VLA+   I  +VL E GC+ YQP+ID  +E SFQR D  SI
Sbjct  1   MITVIAEIKTHAGDEHREAVLAALHSIRTEVLGEDGCHGYQPMIDHASEVSFQRHDAQSI  60

Query  61  MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRIL  100
           +M E WESVAHL+AHLQTAHM A+Q RVK HV  VDIRIL
Sbjct  61  VMLEHWESVAHLEAHLQTAHMQAYQARVKAHVIEVDIRIL  100


> N8PRR8 ABM domain-containing protein [Acinetobacter sp. CIP-A165]
Length=104

 Score =  131 bits (330),  Expect = 6e-44
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRTH  AEHRQ VLA+FE+I+P VLAE GC+ Y PLID       Q  D +SI
Sbjct  1    MLTIIAEIRTHQAAEHRQAVLAAFEKIIPTVLAEDGCHGYAPLIDHLPAIEMQTQDENSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M EQWES AHL+AH+QTAHML H E  KDHVA V +RIL+
Sbjct  61   VMLEQWESTAHLEAHMQTAHMLKHFEATKDHVADVKVRILE  101


> N9FIN6 ABM domain-containing protein [Acinetobacter haemolyticus 
NIPH 261]
Length=104

 Score =  130 bits (327),  Expect = 2e-43
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEI+TH GAEHRQ VL +F++I+P VLAE GC+ Y PLID   E + Q  D +SI
Sbjct  1    MLTIIAEIQTHAGAEHRQAVLDAFQKIIPTVLAEEGCHGYAPLIDHLPEIAMQTQDENSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M EQWES+AHL+AH+QTAHML H E  K HVA V +RIL+
Sbjct  61   VMLEQWESIAHLEAHMQTAHMLKHFEATKAHVADVKVRILE  101


> A0A014EZZ9 Putative quinol monooxygenase ygiN [Acinetobacter 
sp. 25977_3]
Length=104

 Score =  128 bits (321),  Expect = 1e-42
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRT +G +HRQ VL +F++I+P VLAE GC+ Y+PLID  + ASFQ  + D+I
Sbjct  1    MLTIIAEIRTQSGGQHRQNVLDAFQKIIPTVLAEEGCHGYEPLIDHKSNASFQTQEPDTI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M E+WESVAHL+AHL T HM AH E VKD V  V IRIL+
Sbjct  61   VMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIRILE  101


> A0A014D5C9 Putative quinol monooxygenase ygiN [Acinetobacter 
sp. 25977_4]
Length=104

 Score =  128 bits (321),  Expect = 1e-42
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRT +G +HRQ VL +F++I+P VLAE GC+ Y+PLID  + ASFQ  + D+I
Sbjct  1    MLTIIAEIRTQSGGQHRQNVLDAFQKIIPTVLAEEGCHGYEPLIDHKSNASFQTQEPDTI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M E+WESVAHL+AHL T HM AH E VKD V  V IRIL+
Sbjct  61   VMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIRILE  101


> A0A014CWZ3 Putative quinol monooxygenase ygiN [Acinetobacter 
sp. 25977_1]
Length=104

 Score =  128 bits (321),  Expect = 1e-42
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRT +G +HRQ VL +F++I+P VLAE GC+ Y+PLID  + ASFQ  + D+I
Sbjct  1    MLTIIAEIRTQSGGQHRQNVLDAFQKIIPTVLAEEGCHGYEPLIDHKSNASFQTQEPDTI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M E+WESVAHL+AHL T HM AH E VKD V  V IRIL+
Sbjct  61   VMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIRILE  101


> A0A140QU15 Putative quinol monooxygenase ygiN [Acinetobacter 
sp. 216872]
Length=104

 Score =  128 bits (321),  Expect = 1e-42
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRT +G +HRQ VL +F++I+P VLAE GC+ Y+PLID  + ASFQ  + D+I
Sbjct  1    MLTIIAEIRTQSGGQHRQNVLDAFQKIIPTVLAEEGCHGYEPLIDHKSNASFQTQEPDTI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M E+WESVAHL+AHL T HM AH E VKD V  V IRIL+
Sbjct  61   VMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIRILE  101


> A0A062L1C5 Putative quinol monooxygenase ygiN [Acinetobacter 
baumannii 1571545]
Length=104

 Score =  127 bits (320),  Expect = 2e-42
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRT +G +HRQ VL +F++I+P VLAE GC+ Y+PLID  + ASFQ  + D+I
Sbjct  1    MLTIIAEIRTQSGEQHRQNVLDAFQKIIPTVLAEEGCHGYEPLIDHKSNASFQTQEPDTI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M E+WESVAHL+AHL T HM AH E VKD V  V IRIL+
Sbjct  61   VMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIRILE  101


> A0A0E2GE00 ABM domain-containing protein [Acinetobacter nosocomialis 
NIPH 386]
Length=104

 Score =  127 bits (320),  Expect = 2e-42
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRT +G +HRQ VL +F++I+P VLAE GC+ Y+PLID  + ASFQ  + D+I
Sbjct  1    MLTIIAEIRTQSGEQHRQNVLDAFQKIIPTVLAEEGCHGYEPLIDHKSNASFQTQEPDTI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M E+WESVAHL+AHL T HM AH E VKD V  V IRIL+
Sbjct  61   VMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIRILE  101


> A0A2T7FK22 Antibiotic biosynthesis monooxygenase [Acinetobacter 
nosocomialis]
Length=104

 Score =  127 bits (320),  Expect = 2e-42
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+T+IAEIRT +G +HRQ VL +F++I+P VLAE GC+ Y+PLID  + ASFQ  + D+I
Sbjct  1    MLTIIAEIRTQSGEQHRQNVLDAFQKIIPTVLAEEGCHGYEPLIDHKSNASFQTQEPDTI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M E+WESVAHL+AHL T HM AH E VKD V  V IRIL+
Sbjct  61   VMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIRILE  101


> A0A2P8VGY2 Antibiotic biosynthesis monooxygenase [Siccibacter 
turicensis]
Length=104

 Score =  127 bits (318),  Expect = 4e-42
 Identities = 64/101 (63%), Positives = 73/101 (72%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+TVIAEIRT  GA HRQ VL +F +I+P VL E GC+ Y PLID PA+ SFQ  + DSI
Sbjct  1    MLTVIAEIRTRPGAHHRQAVLDAFSRIIPAVLQEAGCHGYAPLIDHPAQVSFQTTNPDSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            MM EQWESVAHL+AHLQT HM A  E VK  V    IRIL+
Sbjct  61   MMLEQWESVAHLEAHLQTPHMKAWSEAVKGDVLETHIRILE  101


 Score = 15.4 bits (28),  Expect = 2.3
 Identities = 7/29 (24%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  74   AHLQTAHMLAHQERVKDHVASVDIRILQD  102
            A ++T     H++ V D  + +   +LQ+
Sbjct  6    AEIRTRPGAHHRQAVLDAFSRIIPAVLQE  34



Lambda      K        H        a         alpha
   0.328    0.134    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 88998


  Database: b0caaa9bae5f5d673f6f3a649587f8c1.TrEMBL.fasta
    Posted date:  Oct 1, 2020  5:22 AM
  Number of letters in database: 1,561
  Number of sequences in database:  15



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40