ACIAD3296 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ae25774c42cca80d6d040b10e6c13b51.SwissProt.fasta
           4 sequences; 752 total letters



Query= ACIAD3296

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P0ADU3 Probable quinol monooxygenase YgiN [Escherichia coli O15...   119    2e-39
  P0ADU4 Probable quinol monooxygenase YgiN [Shigella flexneri]        119    2e-39
  P0ADU2 Probable quinol monooxygenase YgiN [Escherichia coli (st...   119    2e-39
  A4VKC4 Ribosomal protein S12 methylthiotransferase RimO [Pseudo...  31.6    4e-06


> P0ADU3 Probable quinol monooxygenase YgiN [Escherichia coli O157:H7]
Length=104

 Score =  119 bits (298),  Expect = 2e-39
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+TVIAEIRT  G  HRQ VL  F +I+P VL E GC+ Y P++D  A  SFQ +  DSI
Sbjct  1    MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M EQWES+AHL+AHLQT HM A+ E VK  V  ++IRILQ
Sbjct  61   VMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQ  101


> P0ADU4 Probable quinol monooxygenase YgiN [Shigella flexneri]
Length=104

 Score =  119 bits (298),  Expect = 2e-39
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+TVIAEIRT  G  HRQ VL  F +I+P VL E GC+ Y P++D  A  SFQ +  DSI
Sbjct  1    MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M EQWES+AHL+AHLQT HM A+ E VK  V  ++IRILQ
Sbjct  61   VMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQ  101


> P0ADU2 Probable quinol monooxygenase YgiN [Escherichia coli (strain 
K12)]
Length=104

 Score =  119 bits (298),  Expect = 2e-39
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 0/101 (0%)

Query  1    MITVIAEIRTHTGAEHRQQVLASFEQILPQVLAEVGCYQYQPLIDAPAEASFQRVDYDSI  60
            M+TVIAEIRT  G  HRQ VL  F +I+P VL E GC+ Y P++D  A  SFQ +  DSI
Sbjct  1    MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSI  60

Query  61   MMFEQWESVAHLQAHLQTAHMLAHQERVKDHVASVDIRILQ  101
            +M EQWES+AHL+AHLQT HM A+ E VK  V  ++IRILQ
Sbjct  61   VMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQ  101


> A4VKC4 Ribosomal protein S12 methylthiotransferase RimO [Pseudomonas 
stutzeri (strain A1501)]
Length=440

 Score = 31.6 bits (70),  Expect = 4e-06
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 8/50 (16%)

Query  32   LAEVGCYQYQPLIDAPAEA--------SFQRVDYDSIMMFEQWESVAHLQ  73
            L  VGC+QY P+  APAEA          ++  +D  M  +Q  S A LQ
Sbjct  326  LDRVGCFQYSPVDGAPAEAMNLEPVPDEIKQDRWDRFMAHQQAISAARLQ  375


 Score = 22.7 bits (47),  Expect = 0.005
 Identities = 10/30 (33%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  29   PQVLAEVGCYQYQPLIDAPAEASFQRVDYD  58
            P VLA  G  QY+ +++A  E     +++D
Sbjct  92   PSVLAVTGPQQYEQVVNAVHEVVPPSIEHD  121


 Score = 18.1 bits (35),  Expect = 0.17
 Identities = 7/34 (21%), Positives = 18/34 (53%), Gaps = 6/34 (18%)

Query  12   TGAEHRQQVLASFEQILPQVLAEVGCYQYQPLID  45
            TG +  +QV+ +  +++P  +      ++ P +D
Sbjct  98   TGPQQYEQVVNAVHEVVPPSI------EHDPFVD  125



Lambda      K        H        a         alpha
   0.328    0.134    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 53792


  Database: ae25774c42cca80d6d040b10e6c13b51.SwissProt.fasta
    Posted date:  Sep 21, 2020  4:55 AM
  Number of letters in database: 752
  Number of sequences in database:  4



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40