ACIAD3422 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 9e018d00625a483160fc8beb144e283b.TrEMBL.fasta
           19 sequences; 19,467 total letters



Query= ACIAD3422

Length=1059
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F787 Multidrug transport protein, outer membrane (RND family)...  2015    0.0   
  N9R6I9 Uncharacterized protein [Acinetobacter colistiniresistens]   1854    0.0   
  S3T8H5 MMPL family transporter [Acinetobacter colistiniresistens]   1847    0.0   
  N9PKW3 Uncharacterized protein [Acinetobacter sp. CIP 64.2]         1840    0.0   
  A0A1Y3F0V2 RND family multidrug transporter outer membrane prot...  1787    0.0   
  A0A1V2UV67 Multidrug transporter [Acinetobacter genomosp. 33YU]     1785    0.0   
  A0A2M8MG52 Multidrug transporter subunit MdtC [Acinetobacter se...  1781    0.0   
  A0A2T5QZC4 Multidrug transporter subunit MdtC [Acinetobacter se...  1780    0.0   
  A0A0B2XMJ1 Multidrug transporter [Acinetobacter baumannii]          1780    0.0   
  Q79MP3 Multidrug resistance protein MdtC [Serratia marcescens]      1143    0.0   
  Q4LDT8 RND multidrug efflux transporter MexN [Pseudomonas aerug...   817    0.0   
  Q84GI8 Resistance-nodulation-cell division family efflux pump p...   513    2e-171
  Q6PKZ7 Efflux pump membrane transporter [Campylobacter coli]         441    6e-139
  Q8RTE4 Efflux pump membrane transporter [Campylobacter jejuni]       438    6e-138
  Q0PBE4 Efflux pump membrane transporter [Campylobacter jejuni s...   436    2e-137
  A6P7G9 Multidrug efflux transporter VexB [Vibrio cholerae]           436    3e-137
  Q1A4H5 Efflux pump membrane transporter [Campylobacter coli]         432    1e-135
  Q1A4H7 Efflux pump membrane transporter [Campylobacter jejuni]       427    4e-134
  A0A1C9A1J1 Efflux pump membrane transporter [Campylobacter jejuni]   426    2e-133


> Q6F787 Multidrug transport protein, outer membrane (RND family) 
[Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=1058

 Score = 2015 bits (5221),  Expect = 0.0
 Identities = 1058/1058 (100%), Positives = 1058/1058 (100%), Gaps = 0/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP
Sbjct  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS
Sbjct  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD
Sbjct  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI
Sbjct  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
             RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL
Sbjct  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP
Sbjct  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT
Sbjct  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL
Sbjct  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA
Sbjct  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL
Sbjct  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
             KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS
Sbjct  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP
Sbjct  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL
Sbjct  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF
Sbjct  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ
Sbjct  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ
Sbjct  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK
Sbjct  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058


> N9R6I9 Uncharacterized protein [Acinetobacter colistiniresistens]
Length=1058

 Score = 1854 bits (4803),  Expect = 0.0
 Identities = 965/1058 (91%), Positives = 1016/1058 (96%), Gaps = 0/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLS+GLVLLG+LAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSIGLVLLGVLAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITS+SSLG+TRITLQFDLNRDINGAARDVQGAINASLASLP
Sbjct  61    ATVATPLERNLGRIAGVNEITSSSSLGSTRITLQFDLNRDINGAARDVQGAINASLASLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAP+MILALTSKTLSRGQ+YD ADTILGQKLLQIDGVGDV+IGG+
Sbjct  121   SGLQNNPTYRKANPADAPVMILALTSKTLSRGQMYDVADTILGQKLLQIDGVGDVSIGGA  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVRVELNPSQLAHYG+GLD VRSAITSTNANRPKGFVEQK+QLWEV+ANDQA+QAAD
Sbjct  181   AQPAVRVELNPSQLAHYGVGLDTVRSAITSTNANRPKGFVEQKDQLWEVQANDQAKQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             +IPLIVSYKNGAA+RISDVA V+D++LD HNAGYYADQP+VL+MVFKQ NANVIETIQRI
Sbjct  241   YIPLIVSYKNGAAVRISDVATVKDAVLDIHNAGYYADQPSVLIMVFKQSNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
             +DTLPTLQQALP QIEIHTAVDRSKTIQASLREIERT+LIAVMLVI+VVFVFLRNGRATL
Sbjct  301   KDTLPTLQQALPPQIEIHTAVDRSKTIQASLREIERTMLIAVMLVIIVVFVFLRNGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISLIGTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP
Sbjct  361   IPAITVPISLIGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISM+VSLT
Sbjct  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMVVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLK +QIKQ++ +      S    I++SE LLVAS+D YLKQQGLFGR+TLL
Sbjct  481   TTPMLCAWWLKQKQIKQLKFDQSTDMSSPPEAITDSEALLVASNDAYLKQQGLFGRITLL  540

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YKRSLA+AL++KAMTLIIFIFTIGLN+YLYI VPKGFFPQQDTGVMMGSLVADQNISFDA
Sbjct  541   YKRSLAVALRHKAMTLIIFIFTIGLNIYLYIAVPKGFFPQQDTGVMMGSLVADQNISFDA  600

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MN KLK+ +  IGKDPAVDHVMGT  GSQMNRANLFLALKPLSERTD PDQIMARLRK+L
Sbjct  601   MNQKLKNYITAIGKDPAVDHVMGTAGGSQMNRANLFLALKPLSERTDTPDQIMARLRKSL  660

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
              +EAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAAL+KLPALTDVS
Sbjct  661   GHEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALNKLPALTDVS  720

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKL FDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYN MNQYHVVMEVAP
Sbjct  721   SDQDVKGLETKLTFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNPMNQYHVVMEVAP  780

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             EYA+TVEALRGIYVQN+AGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLN GYSL
Sbjct  781   EYARTVEALRGIYVQNSAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNAGYSL  840

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDAT QINQAMN LQVPSSVRG FQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYEDF
Sbjct  841   SDATDQINQAMNELQVPSSVRGGFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYEDF  900

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIALVLF MEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ
Sbjct  901   AHPLTILSTLPSAGLGALIALVLFKMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             QKL PE AILDASVLRFRPI+MTTLAALFGALPLALGRGDGAELH+PLGVSIVGGLIISQ
Sbjct  961   QKLTPETAILDASVLRFRPIMMTTLAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQ  1020

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQ SRWG+R+ Q++FPAK LSLKK
Sbjct  1021  ILTLYSTPVMYLYIDQLSRWGKRRFQNLFPAKPLSLKK  1058


> S3T8H5 MMPL family transporter [Acinetobacter colistiniresistens]
Length=1057

 Score = 1847 bits (4783),  Expect = 0.0
 Identities = 960/1055 (91%), Positives = 1011/1055 (96%), Gaps = 0/1055 (0%)

Query  4     STPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATV  63
             STPFIRRPVATTLLS+GLVLLG+LAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATV
Sbjct  3     STPFIRRPVATTLLSIGLVLLGVLAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATV  62

Query  64    ATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGL  123
             ATPLERNLGRIAGVNEITS+SSLG+TRITLQFDLNRDINGAARDVQGAINASLASLPSGL
Sbjct  63    ATPLERNLGRIAGVNEITSSSSLGSTRITLQFDLNRDINGAARDVQGAINASLASLPSGL  122

Query  124   QNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQP  183
             QNNPTYRKANPADAP+MILALTSKTLSRGQ+YD ADTILGQKLLQIDGVGDV+IGG+AQP
Sbjct  123   QNNPTYRKANPADAPVMILALTSKTLSRGQMYDVADTILGQKLLQIDGVGDVSIGGAAQP  182

Query  184   AVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIP  243
             AVRVELNPSQLAHYG+GLD VRSAITSTNANRPKGFVEQK+QLWEV+ANDQA+QAAD+IP
Sbjct  183   AVRVELNPSQLAHYGVGLDTVRSAITSTNANRPKGFVEQKDQLWEVQANDQAKQAADYIP  242

Query  244   LIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDT  303
             LIVSYKNGAA+RISDVA V+D++LD HNAGYYADQP+VL+MVFKQPNANVIETIQRI+DT
Sbjct  243   LIVSYKNGAAVRISDVATVKDAVLDIHNAGYYADQPSVLIMVFKQPNANVIETIQRIKDT  302

Query  304   LPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPA  363
             LPTLQQALP QIEIHTAVDRSKTIQASLREIERT+LIAVMLVI+VVFVFLRNGRATLIPA
Sbjct  303   LPTLQQALPPQIEIHTAVDRSKTIQASLREIERTMLIAVMLVIIVVFVFLRNGRATLIPA  362

Query  364   ITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQA  423
             ITVPISLIGTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRR+EEGLSPMQA
Sbjct  363   ITVPISLIGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRMEEGLSPMQA  422

Query  424   AITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTP  483
             AITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISM+VSLT TP
Sbjct  423   AITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMVVSLTATP  482

Query  484   MLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKR  543
             MLCAWWLK  QIKQ++ +      S    I++SE LLVAS+D YLKQQGLFGR+TLLYKR
Sbjct  483   MLCAWWLKQNQIKQLKFDQSTDMSSPPEAITDSEALLVASNDAYLKQQGLFGRITLLYKR  542

Query  544   SLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNT  603
             SLA+AL++KAMTLIIFIFTIGLN+YLYI VPKGFFPQQDTGVMMGSLVADQNISFDAMN 
Sbjct  543   SLAVALRHKAMTLIIFIFTIGLNIYLYIAVPKGFFPQQDTGVMMGSLVADQNISFDAMNQ  602

Query  604   KLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYE  663
             KLK+ +  IGKDPAVDHVMGT  GSQMNRANLFLALKPLSERTD PDQIMARLRK+L +E
Sbjct  603   KLKNYITAIGKDPAVDHVMGTAGGSQMNRANLFLALKPLSERTDTPDQIMARLRKSLGHE  662

Query  664   AGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQ  723
             AGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAAL+KLPALTDVSSDQ
Sbjct  663   AGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALNKLPALTDVSSDQ  722

Query  724   DVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYA  783
             DVKGLETKL FDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYN MNQYHVVMEVAPEYA
Sbjct  723   DVKGLETKLTFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNPMNQYHVVMEVAPEYA  782

Query  784   QTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDA  843
             +TVEALRGIYVQN+AGQSIPLSTFS WQAANTSLSVNHQGLFAASTITFNLN GYSLSDA
Sbjct  783   RTVEALRGIYVQNSAGQSIPLSTFSAWQAANTSLSVNHQGLFAASTITFNLNAGYSLSDA  842

Query  844   TVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHP  903
             T QIN AMN LQVPSSVRG FQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYEDFAHP
Sbjct  843   TDQINHAMNELQVPSSVRGGFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYEDFAHP  902

Query  904   LTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKL  963
             LTILSTLPSAGLGALIALVLF MEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKL
Sbjct  903   LTILSTLPSAGLGALIALVLFKMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKL  962

Query  964   PPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILT  1023
              PE AILDASVLRFRPI+MTTLAALFGALPLALGRGDGAELH+PLGVSIVGGLIISQILT
Sbjct  963   TPETAILDASVLRFRPIMMTTLAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQILT  1022

Query  1024  LYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             LYSTPVMYLYIDQ SRWG+R+ Q++FPAKSLSLKK
Sbjct  1023  LYSTPVMYLYIDQLSRWGKRRFQNLFPAKSLSLKK  1057


> N9PKW3 Uncharacterized protein [Acinetobacter sp. CIP 64.2]
Length=1057

 Score = 1840 bits (4766),  Expect = 0.0
 Identities = 957/1058 (90%), Positives = 1013/1058 (96%), Gaps = 1/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLS+GLVLLG+LAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSIGLVLLGVLAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITS+SSLG+TRITLQFDLNRDINGAARDVQGAINASLASLP
Sbjct  61    ATVATPLERNLGRIAGVNEITSSSSLGSTRITLQFDLNRDINGAARDVQGAINASLASLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAP+MILALTSKTLSRGQ+YD ADTILGQKLLQIDGVGDV+IGG+
Sbjct  121   SGLQNNPTYRKANPADAPVMILALTSKTLSRGQMYDVADTILGQKLLQIDGVGDVSIGGA  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVR+ELNPSQLAH+GIGLD VRSAITSTNANRPKGFVEQK+QLWEV+ANDQA+QAAD
Sbjct  181   AQPAVRIELNPSQLAHHGIGLDTVRSAITSTNANRPKGFVEQKDQLWEVQANDQAKQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             +IPLIVSYKNGAA+RISDVA V+D++LD  NAGYY DQP+VL+MVFKQPNANVIETIQRI
Sbjct  241   YIPLIVSYKNGAAVRISDVATVKDAVLDIRNAGYYVDQPSVLIMVFKQPNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
             +DTLPTLQQALP QIEIHTAVDRSKTIQASLREIERT+LIAVMLVI+VVFVFLRNGRATL
Sbjct  301   KDTLPTLQQALPPQIEIHTAVDRSKTIQASLREIERTMLIAVMLVIIVVFVFLRNGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISLIGTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRR+EEGLSP
Sbjct  361   IPAITVPISLIGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRMEEGLSP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISM+VSLT
Sbjct  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMVVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLK  QIKQ++ +    +   T  I++SE LLVAS+D YLKQQGLFGR+TLL
Sbjct  481   TTPMLCAWWLKQNQIKQLKFDQ-STDNPSTEVITDSEALLVASNDTYLKQQGLFGRITLL  539

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YKRSLA+ALQYKA+TLIIFIFTIGLN+YLYI VPKGFFPQQDTGVM+GSLVADQNISFDA
Sbjct  540   YKRSLAVALQYKAITLIIFIFTIGLNIYLYIAVPKGFFPQQDTGVMIGSLVADQNISFDA  599

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MN KLK+ +A I KDPAVDHVMGT  GSQMNRANLFLALKPLSER D PDQIMARLRK+L
Sbjct  600   MNQKLKNYIAAIAKDPAVDHVMGTAGGSQMNRANLFLALKPLSERNDTPDQIMARLRKSL  659

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
              +EAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAAL+KLPALTDVS
Sbjct  660   GHEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALNKLPALTDVS  719

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKL FDHDKMKSLGITQ+QVDSTLNDAFGQRQVSTIYN MNQYHVV+EVAP
Sbjct  720   SDQDVKGLETKLTFDHDKMKSLGITQAQVDSTLNDAFGQRQVSTIYNPMNQYHVVIEVAP  779

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             EYA+TVEALRGIYVQN+AG+SIPLSTFS WQAANTSLSVNHQGLFAASTITFNLN GYSL
Sbjct  780   EYARTVEALRGIYVQNSAGKSIPLSTFSAWQAANTSLSVNHQGLFAASTITFNLNAGYSL  839

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDAT QINQAMN LQVPSSVRG FQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYEDF
Sbjct  840   SDATDQINQAMNELQVPSSVRGGFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYEDF  899

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIALVLF MEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ
Sbjct  900   AHPLTILSTLPSAGLGALIALVLFKMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  959

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             QKL PE AILDASVLRFRPI+MTTLAALFGALPLALGRGDGAELH+PLGVSIVGGLIISQ
Sbjct  960   QKLTPETAILDASVLRFRPIMMTTLAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQ  1019

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQ SRWG+R+ Q++FPAK LSLKK
Sbjct  1020  ILTLYSTPVMYLYIDQLSRWGKRRFQNLFPAKPLSLKK  1057


> A0A1Y3F0V2 RND family multidrug transporter outer membrane protein 
[Acinetobacter seifertii]
Length=1057

 Score = 1787 bits (4628),  Expect = 0.0
 Identities = 923/1058 (87%), Positives = 996/1058 (94%), Gaps = 1/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLS+GLVLLG LAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSIGLVLLGFLAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITS+S+LG+TRITLQFDLNRDINGAARDVQGAINASL+SLP
Sbjct  61    ATVATPLERNLGRIAGVNEITSSSTLGSTRITLQFDLNRDINGAARDVQGAINASLSSLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAP+MILALTSKTLSRGQ+YDAADTILGQKLLQI+GVGDV+IGG+
Sbjct  121   SGLQNNPTYRKANPADAPVMILALTSKTLSRGQMYDAADTILGQKLLQIEGVGDVSIGGA  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVRVELNPSQLAHYGIGLD VRSAITSTNANRPKGF+E+K +LWEVKANDQA+QAAD
Sbjct  181   AQPAVRVELNPSQLAHYGIGLDTVRSAITSTNANRPKGFIEKKQELWEVKANDQAKQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             +IPLIVSYKNG A+RISDV +V+DS+LD  NAGYYADQP+VL+MVFKQPNANVIETIQRI
Sbjct  241   YIPLIVSYKNGGAVRISDVGEVKDSVLDIRNAGYYADQPSVLIMVFKQPNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
                LPTLQQALPSQIEIHTAVDRSKTIQASLREIERTL+IA++LVI+VVFVFL+ GRATL
Sbjct  301   NQMLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLIIAIILVIIVVFVFLKKGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISL+GTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRR+EEGL+P
Sbjct  361   IPAITVPISLVGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRMEEGLAP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGA+EVSFTV+SMSISLIAVFVPILLMGGIVGRLFHEFAMTL+YAILISM+VSLT
Sbjct  421   MQAAITGAREVSFTVISMSISLIAVFVPILLMGGIVGRLFHEFAMTLSYAILISMVVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLK  +  Q  PE L  E++  T    SE LLVASDDEYLK+QGLFGR+TLL
Sbjct  481   TTPMLCAWWLKRNKKNQPNPENLIAEQTSKTD-DYSEALLVASDDEYLKKQGLFGRITLL  539

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YKRSLA+AL++KAMT+IIFIFTIGLNVYLYI VPKGFFPQQDTGVMMGSLVADQNISFDA
Sbjct  540   YKRSLAVALRHKAMTMIIFIFTIGLNVYLYIAVPKGFFPQQDTGVMMGSLVADQNISFDA  599

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MNTKLK  +AVIGKDPAVDHVMGT+ GSQ+NRANLFLALKPL ERTD PDQIMARLRK L
Sbjct  600   MNTKLKKYIAVIGKDPAVDHVMGTLGGSQLNRANLFLALKPLGERTDTPDQIMARLRKVL  659

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
              +EAG RF+LRPVQDIN+GGRSSDASYQYTLQGDDL  LRSWTPKIQAALSKLPALTDVS
Sbjct  660   GHEAGIRFSLRPVQDINIGGRSSDASYQYTLQGDDLTALRSWTPKIQAALSKLPALTDVS  719

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKL FDHDKMK +GITQ+QVDSTLNDAFGQRQVSTIYN MNQYHVVMEVAP
Sbjct  720   SDQDVKGLETKLSFDHDKMKMMGITQAQVDSTLNDAFGQRQVSTIYNPMNQYHVVMEVAP  779

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             EYA++VEAL  IY+Q+  GQSIPLSTFS+W+AANTSLSVNHQGLFAASTITFNLN GYSL
Sbjct  780   EYAKSVEALNSIYIQDAQGQSIPLSTFSSWKAANTSLSVNHQGLFAASTITFNLNDGYSL  839

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDAT+QIN AMN L+VP+S+RGSFQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYE F
Sbjct  840   SDATLQINNAMNELKVPTSIRGSFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYESF  899

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIAL+LF MEF+VIALIGILLLIGIVKKNAIMMIDVALTLQR+
Sbjct  900   AHPLTILSTLPSAGLGALIALILFKMEFTVIALIGILLLIGIVKKNAIMMIDVALTLQRK  959

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             Q L PE AILDASVLRFRPI+MTT AALFGALPLALGRGDGAELH+PLGVSIVGGLIISQ
Sbjct  960   QSLKPETAILDASVLRFRPIMMTTFAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQ  1019

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQ S WG+RK ++I+  K + LKK
Sbjct  1020  ILTLYSTPVMYLYIDQLSEWGKRKFKNIWSMKQMGLKK  1057


> A0A1V2UV67 Multidrug transporter [Acinetobacter genomosp. 33YU]
Length=1057

 Score = 1785 bits (4624),  Expect = 0.0
 Identities = 922/1058 (87%), Positives = 996/1058 (94%), Gaps = 1/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLS+GLVLLG LAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSIGLVLLGFLAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITS+S+LG+TRITLQFDLNRDINGAARDVQGAINASL+SLP
Sbjct  61    ATVATPLERNLGRIAGVNEITSSSTLGSTRITLQFDLNRDINGAARDVQGAINASLSSLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAP+MILALTSKTLSRGQ+YDAADTILGQKLLQI+GVGDV+IGG+
Sbjct  121   SGLQNNPTYRKANPADAPVMILALTSKTLSRGQMYDAADTILGQKLLQIEGVGDVSIGGA  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVRVELNPSQLAHYGIGLD VRSAITSTNANRPKGF+E+K +LWEVKANDQA+QAAD
Sbjct  181   AQPAVRVELNPSQLAHYGIGLDTVRSAITSTNANRPKGFIEKKQELWEVKANDQAKQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             +IPLIVSYKNG A+RISDV +V+DS+LD  NAGYYADQP+VL+MVFKQPNANVIETIQRI
Sbjct  241   YIPLIVSYKNGGAVRISDVGEVKDSVLDIRNAGYYADQPSVLIMVFKQPNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
                LPTLQQALPSQIEIHTAVDRSKTIQASLREIERTL+IA++LVI+VVFVFL+NGRATL
Sbjct  301   NQMLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLIIAIILVIIVVFVFLKNGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISL+GTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRR+EEGL+P
Sbjct  361   IPAITVPISLVGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRMEEGLAP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGA+EVSFTV+SMSISLIAVFVPILLMGGIVGRLFHEFAMTL+YAILISM+VSLT
Sbjct  421   MQAAITGAREVSFTVISMSISLIAVFVPILLMGGIVGRLFHEFAMTLSYAILISMVVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLK  +  Q   E L  E++  T    SE LLVASDDEYLK+QGLFGR+TLL
Sbjct  481   TTPMLCAWWLKRNKKNQPNTENLIAEQASKTD-DYSEALLVASDDEYLKKQGLFGRITLL  539

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YKRSLA+AL++KAMT+IIFIFTIGLNVYLYI VPKGFFPQQDTG+MMGSLVADQNISFDA
Sbjct  540   YKRSLAVALRHKAMTMIIFIFTIGLNVYLYIAVPKGFFPQQDTGIMMGSLVADQNISFDA  599

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MNTKLK  +AVIGKDPAVDHVMGT+ GSQ+NRANLFLALKPL ERTD PDQIMARLRK L
Sbjct  600   MNTKLKKYIAVIGKDPAVDHVMGTLGGSQLNRANLFLALKPLGERTDTPDQIMARLRKVL  659

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
              +EAG RF+LRPVQDIN+GGRSSDASYQYTLQGDDL  LRSWTP+IQAALSKLPALTDVS
Sbjct  660   GHEAGIRFSLRPVQDINIGGRSSDASYQYTLQGDDLTALRSWTPQIQAALSKLPALTDVS  719

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKL FDHDKMK +GITQ+QVDSTLNDAFGQRQVSTIYN MNQYHVVMEVAP
Sbjct  720   SDQDVKGLETKLSFDHDKMKMMGITQAQVDSTLNDAFGQRQVSTIYNPMNQYHVVMEVAP  779

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             EYA++VEAL  IY+Q+  GQSIPLSTFS+W+AANTSLSVNHQGLFAASTITFNLN GYSL
Sbjct  780   EYAKSVEALNSIYIQDAQGQSIPLSTFSSWKAANTSLSVNHQGLFAASTITFNLNDGYSL  839

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDATVQIN AMN L+VP+S+RGSFQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYE F
Sbjct  840   SDATVQINNAMNELKVPTSIRGSFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYESF  899

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIAL+LF MEF+VIALIGILLLIGIVKKNAIMMIDVALTLQR+
Sbjct  900   AHPLTILSTLPSAGLGALIALILFKMEFTVIALIGILLLIGIVKKNAIMMIDVALTLQRK  959

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             Q L PE AILDASVLRFRPI+MTT AALFGALPLALGRGDGAELH+PLGVSIVGGLIISQ
Sbjct  960   QSLKPETAILDASVLRFRPIMMTTFAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQ  1019

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQ S WG+RK ++I+  K + LKK
Sbjct  1020  ILTLYSTPVMYLYIDQLSEWGKRKFKNIWSMKQMGLKK  1057


> A0A2M8MG52 Multidrug transporter subunit MdtC [Acinetobacter 
seifertii]
Length=1057

 Score = 1781 bits (4614),  Expect = 0.0
 Identities = 920/1058 (87%), Positives = 996/1058 (94%), Gaps = 1/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLS+GLVLLG LAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSIGLVLLGFLAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITS+S+LG+TRITLQFDLNRDINGAARDVQGAINASL++LP
Sbjct  61    ATVATPLERNLGRIAGVNEITSSSTLGSTRITLQFDLNRDINGAARDVQGAINASLSALP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAP+MILALTSKTLSRGQ+YDAADTILGQKLLQI+GVGDV+IGG+
Sbjct  121   SGLQNNPTYRKANPADAPVMILALTSKTLSRGQMYDAADTILGQKLLQIEGVGDVSIGGA  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVRVELNPSQLAHYGIGLD VRSAITSTNANRPKGF+E+K +LWEVKANDQA+QAAD
Sbjct  181   AQPAVRVELNPSQLAHYGIGLDTVRSAITSTNANRPKGFIEKKQELWEVKANDQAKQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             +IPLIVSYKNG A+RISDV +V+DS+LD  NAGYYADQP+VL+MVFKQPNANVIETIQRI
Sbjct  241   YIPLIVSYKNGGAVRISDVGEVKDSVLDIRNAGYYADQPSVLIMVFKQPNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
                LPTLQQALPSQIEIHTAVDRSKTIQASLREIERTL+IA++LVI+VVFVFL+NGRATL
Sbjct  301   NQMLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLIIAIILVIIVVFVFLKNGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISL+GTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRR+EEGL+P
Sbjct  361   IPAITVPISLVGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRMEEGLAP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGA+EVSFTV+SMSISLIAVFVPILLMGGIVGRLFHEFAMTL+YAILISM+VSLT
Sbjct  421   MQAAITGAREVSFTVISMSISLIAVFVPILLMGGIVGRLFHEFAMTLSYAILISMVVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLK  +  Q   E L  E++  T    SE LLVASDDEYLK+QGLFGR+TLL
Sbjct  481   TTPMLCAWWLKRNKKNQPNTENLIAEQTSKTD-DYSEALLVASDDEYLKKQGLFGRITLL  539

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YKRSLA+AL++KAMT+IIFIFTIGLNVYLYI VPKGFFPQQDTGVMMGSLVADQNISFDA
Sbjct  540   YKRSLAVALRHKAMTMIIFIFTIGLNVYLYIAVPKGFFPQQDTGVMMGSLVADQNISFDA  599

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MNTKLK  +AVIGKDPAVDHVMGT+ GSQ+NRANLFLALKPL ERTD PDQIMARLRK L
Sbjct  600   MNTKLKKYIAVIGKDPAVDHVMGTLGGSQLNRANLFLALKPLGERTDTPDQIMARLRKVL  659

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
              +EAG RF+LRPVQDIN+GGRSSDASYQYTLQGDDL  LRSWTP+IQAALSKLPALTDVS
Sbjct  660   GHEAGIRFSLRPVQDINIGGRSSDASYQYTLQGDDLTALRSWTPQIQAALSKLPALTDVS  719

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKL FDHDKMK +GITQ+QVDSTLNDAFGQRQVSTIYN MNQYHVVMEVAP
Sbjct  720   SDQDVKGLETKLSFDHDKMKMMGITQAQVDSTLNDAFGQRQVSTIYNPMNQYHVVMEVAP  779

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             EYA++VEAL  IY+Q+  GQSIPLSTFS+W+AANTSLSVNHQGLFAASTITFNL+ GYSL
Sbjct  780   EYAKSVEALNSIYIQDAQGQSIPLSTFSSWKAANTSLSVNHQGLFAASTITFNLSDGYSL  839

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDAT+QIN AMN L+VP+S+RGSFQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYE F
Sbjct  840   SDATLQINSAMNELKVPTSIRGSFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYESF  899

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIAL+LF MEF+VIALIGILLLIGIVKKNAIMMIDVALTLQR+
Sbjct  900   AHPLTILSTLPSAGLGALIALILFKMEFTVIALIGILLLIGIVKKNAIMMIDVALTLQRK  959

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             Q L PE AILDASVLRFRPI+MTT AALFGALPLALGRGDGAELH+PLGVSIVGGLIISQ
Sbjct  960   QSLKPETAILDASVLRFRPIMMTTFAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQ  1019

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQ S WG+RK ++I+  K + LKK
Sbjct  1020  ILTLYSTPVMYLYIDQLSEWGKRKFKNIWSMKQMGLKK  1057


> A0A2T5QZC4 Multidrug transporter subunit MdtC [Acinetobacter 
seifertii]
Length=1057

 Score = 1780 bits (4611),  Expect = 0.0
 Identities = 919/1058 (87%), Positives = 995/1058 (94%), Gaps = 1/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLS+GLVLLG+LAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSIGLVLLGLLAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITS+S+LG+TRITLQFDLNRDINGAARDVQGAINASL+SLP
Sbjct  61    ATVATPLERNLGRIAGVNEITSSSTLGSTRITLQFDLNRDINGAARDVQGAINASLSSLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAP+MILALTSKTLSRGQ+YD ADTILGQKLLQI+GVGDV+IGG+
Sbjct  121   SGLQNNPTYRKANPADAPVMILALTSKTLSRGQMYDVADTILGQKLLQIEGVGDVSIGGA  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVRVELNPSQLAHYGIGLD VRSAITSTNANRPKGF+E+K +LWEVKANDQA+QAAD
Sbjct  181   AQPAVRVELNPSQLAHYGIGLDTVRSAITSTNANRPKGFIEKKQELWEVKANDQAKQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             +IPLIVSYKNG A+RISDV +V+DS+LD  NAGYYADQP+VL+MVFKQPNANVIETIQRI
Sbjct  241   YIPLIVSYKNGGAVRISDVGEVKDSVLDIRNAGYYADQPSVLIMVFKQPNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
                LPTLQQALPSQIEIHTAVDRSKTIQASLREIERTL+IA++LVI+VVFVFL+NGRATL
Sbjct  301   NQMLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLIIAIILVIIVVFVFLKNGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISL+GTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRR+EEGL+P
Sbjct  361   IPAITVPISLVGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRMEEGLAP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGA+EVSFTV+SMSISLIAVFVPILLMGGIVGRLFHEFAMTL+YAILISM+VSLT
Sbjct  421   MQAAITGAREVSFTVISMSISLIAVFVPILLMGGIVGRLFHEFAMTLSYAILISMVVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLK  +  Q   E L  E++       S+ LLVASDDEYLK+QGLFGR+TLL
Sbjct  481   TTPMLCAWWLKRNKKNQPSTENLIAEQTSEND-DYSKALLVASDDEYLKKQGLFGRITLL  539

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YKRSLA+ALQ+KAMT+IIFIFTIGLNVYLYI VPKGFFPQQDTGVMMGSLVADQNISFDA
Sbjct  540   YKRSLAVALQHKAMTMIIFIFTIGLNVYLYIAVPKGFFPQQDTGVMMGSLVADQNISFDA  599

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MNTKLK  +AVIGKDPAVDHVMGT+ GSQ+NRANLFLALKPL ERTD PDQIMARLRK L
Sbjct  600   MNTKLKKYIAVIGKDPAVDHVMGTLGGSQLNRANLFLALKPLGERTDTPDQIMARLRKVL  659

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
              +EAG RF+LRPVQDIN+GGRSSDASYQYTLQGDDL  LRSWTPKIQAALSKLPALTDVS
Sbjct  660   GHEAGIRFSLRPVQDINIGGRSSDASYQYTLQGDDLTALRSWTPKIQAALSKLPALTDVS  719

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKL FDHDKMK +GITQ+QVDSTLNDAFGQRQVSTIYN MNQYHVVMEVAP
Sbjct  720   SDQDVKGLETKLSFDHDKMKMMGITQAQVDSTLNDAFGQRQVSTIYNPMNQYHVVMEVAP  779

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             E+A++VEAL  IY+Q+  GQSIPLSTFS+W+AANTSLSVNHQGLFAASTITFNLN GYSL
Sbjct  780   EFAKSVEALNSIYIQDAQGQSIPLSTFSSWKAANTSLSVNHQGLFAASTITFNLNDGYSL  839

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDAT+QIN AMN L+VP+++RGSFQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYE F
Sbjct  840   SDATLQINNAMNELKVPTAIRGSFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYESF  899

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIAL+LF MEF+VIALIGILLLIGIVKKNAIMMIDVALTLQR+
Sbjct  900   AHPLTILSTLPSAGLGALIALILFKMEFTVIALIGILLLIGIVKKNAIMMIDVALTLQRK  959

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             Q L PE AILDASVLRFRPI+MTT AALFGALPLALGRGDGAELH+PLGVSIVGGLIISQ
Sbjct  960   QSLKPETAILDASVLRFRPIMMTTFAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQ  1019

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQ S WG+RK ++I+  K + LKK
Sbjct  1020  ILTLYSTPVMYLYIDQLSEWGKRKFKNIWSMKQMGLKK  1057


> A0A0B2XMJ1 Multidrug transporter [Acinetobacter baumannii]
Length=1057

 Score = 1780 bits (4610),  Expect = 0.0
 Identities = 921/1058 (87%), Positives = 993/1058 (94%), Gaps = 1/1058 (0%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             MSISTPFIRRPVATTLLS+GLVLLG LAFNILPVASLPRVDFPTISVTAKQAGASPEVMA
Sbjct  1     MSISTPFIRRPVATTLLSIGLVLLGFLAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ATVATPLERNLGRIAGVNEITS+S+LG+TRITLQFDLNRDINGAARDVQGAINASL+SLP
Sbjct  61    ATVATPLERNLGRIAGVNEITSSSTLGSTRITLQFDLNRDINGAARDVQGAINASLSSLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SGLQNNPTYRKANPADAP+MILALTSKTLSRGQ+YDAADTILGQKLLQI+GVGDV+IGG+
Sbjct  121   SGLQNNPTYRKANPADAPVMILALTSKTLSRGQMYDAADTILGQKLLQIEGVGDVSIGGA  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             AQPAVRVELNPSQLAHYGIGLD VRSAITSTNANRPKGF+E+K +LWEVKANDQA+QAAD
Sbjct  181   AQPAVRVELNPSQLAHYGIGLDTVRSAITSTNANRPKGFIEKKQELWEVKANDQAKQAAD  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             +IPLIVSYKNG A+RISDV +V+DS+LD  NAGYYADQP+VL+MVFKQPNANVIETIQRI
Sbjct  241   YIPLIVSYKNGGAVRISDVGEVKDSVLDIRNAGYYADQPSVLIMVFKQPNANVIETIQRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
                LPTLQQALPSQIEIHTAVDRSKTIQASLREIERTL+IA++LVI+VVFVFL+NGRATL
Sbjct  301   NQMLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLIIAIILVIIVVFVFLKNGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPAITVPISL+GTF LMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRR+EEGL+P
Sbjct  361   IPAITVPISLVGTFALMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRMEEGLAP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             MQAAITGAKEVSFTV+SMSISLIAVFVPILLMGGIVGRLFHEFAMTL+YAILISM+VSLT
Sbjct  421   MQAAITGAKEVSFTVISMSISLIAVFVPILLMGGIVGRLFHEFAMTLSYAILISMVVSLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
             TTPMLCAWWLK  +  Q   E L  E++  T    SE LLVASDDEYLK+QG+FGR+TLL
Sbjct  481   TTPMLCAWWLKKNKKNQPNTENLIAEQTSKTD-DYSEALLVASDDEYLKKQGIFGRITLL  539

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             YK SLA+AL++KAMT+IIFIFTIGLNVYLYI VPKGFFPQQDTGVMMGSLVADQNISFDA
Sbjct  540   YKCSLAVALRHKAMTMIIFIFTIGLNVYLYIAVPKGFFPQQDTGVMMGSLVADQNISFDA  599

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             MN KLK  +AVIGKDPAVDHVMGT+ GSQ+NRANLFLALKPL ERTD PDQIMARLRK L
Sbjct  600   MNIKLKKYIAVIGKDPAVDHVMGTLGGSQLNRANLFLALKPLGERTDTPDQIMARLRKVL  659

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
              +EAG RF+LRPVQDIN+GGRSSDASYQYTLQGDDL  LRSWTPKIQAALSKLPALTDVS
Sbjct  660   GHEAGIRFSLRPVQDINIGGRSSDASYQYTLQGDDLTALRSWTPKIQAALSKLPALTDVS  719

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQDVKGLETKL FDHDKMK +GITQ+QVDSTLNDAFGQRQVSTIYN MNQYHVVMEVAP
Sbjct  720   SDQDVKGLETKLSFDHDKMKMMGITQAQVDSTLNDAFGQRQVSTIYNPMNQYHVVMEVAP  779

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             EYA++VEAL  IY+Q+  GQSIPLSTFS+W+AANTSLSVNHQGLFAASTITFNLN GYSL
Sbjct  780   EYAKSVEALNSIYIQDAQGQSIPLSTFSSWKAANTSLSVNHQGLFAASTITFNLNDGYSL  839

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             SDATVQIN AMN L+VP+S+RGSFQGSAKAFQ+SLS+EPLLILAAI+VIYIVLGILYE F
Sbjct  840   SDATVQINNAMNELKVPTSIRGSFQGSAKAFQSSLSSEPLLILAAIVVIYIVLGILYESF  899

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
             AHPLTILSTLPSAGLGALIAL+LF MEF+VIALIGILLLIGIVKKNAIMMIDVALTLQR+
Sbjct  900   AHPLTILSTLPSAGLGALIALILFKMEFTVIALIGILLLIGIVKKNAIMMIDVALTLQRK  959

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
             Q L PE AILDASVLRFRPI+MTT AALFGALPLALGRGDGAELH+PLGVSIVGGLIISQ
Sbjct  960   QSLKPETAILDASVLRFRPIMMTTFAALFGALPLALGRGDGAELHVPLGVSIVGGLIISQ  1019

Query  1021  ILTLYSTPVMYLYIDQFSRWGRRKLQHIFPAKSLSLKK  1058
             ILTLYSTPVMYLYIDQ S WG+ K ++I+  K + LKK
Sbjct  1020  ILTLYSTPVMYLYIDQLSEWGKLKFKNIWSMKQMGLKK  1057


> Q79MP3 Multidrug resistance protein MdtC [Serratia marcescens]
Length=1021

 Score = 1143 bits (2957),  Expect = 0.0
 Identities = 595/1040 (57%), Positives = 770/1040 (74%), Gaps = 26/1040 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVATTLL+L + + G + F +LPV+ LP+VDFP IS++A   GASPE MA++VATP
Sbjct  2     FIHRPVATTLLTLAIAISGAIGFRLLPVSPLPQVDFPVISISASLPGASPETMASSVATP  61

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TR+ LQFDL+RDINGAARDVQ AINA+ + LP+G+ + 
Sbjct  62    LERALGRIAGVNEMTSMSSLGSTRVILQFDLDRDINGAARDVQAAINAAQSLLPTGMPSR  121

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             P+YRK NP+DAPIMIL LTS T S+GQ+YD A T L QK+ Q +GVGDV++GGS+ PAVR
Sbjct  122   PSYRKVNPSDAPIMILTLTSDTYSQGQLYDFASTQLAQKISQTEGVGDVSVGGSSLPAVR  181

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LD+VR AI + N  RP+G VE   Q W+++AND  + A  + PLI+
Sbjct  182   VELNPSALFNQGVSLDSVRQAIANANVRRPQGAVENPQQRWQIQANDALKTADAYRPLII  241

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+A+R++DVA+V+DS+ D  NAG    +PA+++ + + P+AN+IET+ RIR  LP 
Sbjct  242   HYNNGSAVRLADVAEVKDSVQDVRNAGMTDAKPAIILAISRAPDANIIETVDRIRAELPA  301

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ+ +P+ I+++ A DRS TI+ASL E+E++L IA+ LVI+VVF+FLR+GRATLIPA+ V
Sbjct  302   LQENIPASIQLNVAQDRSPTIRASLAEVEQSLAIAIGLVILVVFIFLRSGRATLIPAVAV  361

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIG+F  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ P+ AA+ 
Sbjct  362   PVSLIGSFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHVEAGMKPINAALL  421

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             GA+EV FTV+SMS+SL+AVF+P+LLM G+ GRLF EFA+TL+ +I +S++VSLT TPM+C
Sbjct  422   GAREVGFTVLSMSVSLVAVFIPLLLMEGLPGRLFREFAVTLSVSIGLSLIVSLTLTPMMC  481

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             A+ L+ +             RS+       +MLL         QQG        Y RSL 
Sbjct  482   AYLLRHQP-----------ARSQRRARGFGKMLLAL-------QQG--------YGRSLN  515

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +    L +F+ T+ LNV+LYI +PK FFP+QDTG +MG + ADQ+ISF AM  KL+
Sbjct  516   WVLGHSRWVLAVFLATVALNVWLYISIPKTFFPEQDTGRLMGFIQADQSISFQAMRGKLE  575

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++ +DP V++V G   GS+ N  ++F++LKPLS R+D   +++ARLR  L  E G 
Sbjct  576   DFMKIVREDPDVENVTGFTGGSRTNSGSMFISLKPLSVRSDDAQKVIARLRARLAKEPGA  635

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR ++ASYQYTL  DDL  LR W PKI+ AL+ LP L DV+SDQ  K
Sbjct  636   SLFLMAVQDIRVGGRQANASYQYTLLADDLAALREWEPKIRTALAALPELADVNSDQQDK  695

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L++D + M  LGI+ S  ++ LN+AFGQRQ+STIY  +NQY VVMEVAP Y Q V
Sbjct  696   GSEMDLVYDRETMARLGISVSDANNLLNNAFGQRQISTIYQPLNQYKVVMEVAPPYTQDV  755

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  +++ NN G++IPLS F++W+ AN  LSVNHQGL AASTI+FNL  G SLSDAT  
Sbjct  756   SSLDKMFIINNEGKAIPLSYFASWRPANAPLSVNHQGLSAASTISFNLPDGGSLSDATAA  815

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + + M  L VPS+VRG+F G+A+ FQ +L ++ +LILAAI  +YIVLG+LYE + HPLTI
Sbjct  816   VERTMTQLGVPSTVRGAFAGTAQVFQDTLKSQLILILAAIATVYIVLGVLYESYIHPLTI  875

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF   FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  876   LSTLPSAGVGALLALELFGAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRNGGISAR  935

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPI+MTTLAALFGALPL L RGDGAEL  PLG++I GGL++SQ+LTLY+
Sbjct  936   EAIFQASLLRFRPIMMTTLAALFGALPLVLTRGDGAELRQPLGITIAGGLVMSQLLTLYT  995

Query  1027  TPVMYLYIDQFSRWGRRKLQ  1046
             TPV+YLY D+     RR  Q
Sbjct  996   TPVVYLYFDRLQAKFRRNKQ  1015


> Q4LDT8 RND multidrug efflux transporter MexN [Pseudomonas aeruginosa]
Length=1036

 Score =  817 bits (2111),  Expect = 0.0
 Identities = 452/1041 (43%), Positives = 658/1041 (63%), Gaps = 37/1041 (4%)

Query  8     IRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATPL  67
             +R P+AT LL+L  +LLG+LAF  L VA LP  DFPTI + A   G SPE MA++VATPL
Sbjct  12    VRHPIATALLTLASLLLGLLAFLRLGVAPLPEADFPTIQINALLPGGSPETMASSVATPL  71

Query  68    ERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNNP  127
             E     I G+ E+TS+S+LGTT +TLQF L++ I+ AA++VQ AINA+   LP  + N P
Sbjct  72    EVQFSAIPGITEMTSSSALGTTTLTLQFSLDKSIDVAAQEVQAAINAAAGRLPVDMPNLP  131

Query  128   TYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVRV  187
             T+RK NPAD+PIMIL + S+ +   ++ D A+TIL ++L Q++GVG + + G  +PA+R+
Sbjct  132   TWRKVNPADSPIMILRVNSEMMPLIELSDYAETILARQLSQVNGVGQIFVVGQQRPAIRI  191

Query  188   ELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIVS  247
             +  P +LA Y + L  +R ++ S + N  KG +  + ++  + ANDQ   A+D+  L+V+
Sbjct  192   QAQPEKLAAYQLTLADLRQSLQSASVNLAKGALYGEGRVSTLAANDQLFNASDYDDLVVA  251

Query  248   YKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPTL  307
             Y+ GA + + DVA++  +  D +   +    P V +++ +QP AN+++T   I+  LP L
Sbjct  252   YRQGAPVFLKDVARIVSAPEDDYVQAWPNGVPGVALVILRQPGANIVDTADAIQAALPRL  311

Query  308   QQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITVP  367
             ++ LP+ IE+    DR++TI++SL E+E TLL+ + LV++V+ +FLR   ATLI A  + 
Sbjct  312   REMLPATIEVDVLNDRTRTIRSSLHEVELTLLLTIGLVVLVMGLFLRQLSATLIVATVLA  371

Query  368   ISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAITG  427
             +SL  +F  MY  GF+LNN++L+AL IA GF+VDD IVV+E I R +E G S ++AA+ G
Sbjct  372   VSLSASFAAMYVLGFTLNNLTLVALIIAVGFIVDDAIVVVENIHRHLEAGASKVEAALKG  431

Query  428   AKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLCA  487
             A E+ FTV+S+S SLIA F+P+L MGGIVGRLF EFA+++T AILIS++ SLT  PML +
Sbjct  432   AAEIGFTVISISFSLIAAFIPLLFMGGIVGRLFREFAVSVTVAILISVVASLTLAPMLAS  491

Query  488   WWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLAI  547
                      +  P L   E                       ++G    +T  Y+R L  
Sbjct  492   ---------RFMPALRHAE---------------------APRKGFAEWLTGGYERGLRW  521

Query  548   ALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLKH  607
             AL ++ + L+ F FT+ + V  Y+ +PKGFFP QDT  ++G+  A ++IS+D M  K + 
Sbjct  522   ALGHQRLMLVGFAFTVLVAVAGYVGIPKGFFPLQDTAFVIGTSQAAEDISYDDMVAKHRQ  581

Query  608   DMAVIGKDPAV---DHVMGTISGSQ-MNRANLFLALKPLSERTDHPDQIMARLRKALKYE  663
                +I  DPAV   +H +G   GSQ +     ++ LK   ER     + + RLR  L   
Sbjct  582   LAEIIASDPAVQSYNHAVGVTGGSQSLANGRFWIVLKDRGERDVSVGEFIDRLRPQLAKV  641

Query  664   AGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQ  723
              G    LR  QDIN+    S   YQY L+  D   L  W  ++   L ++P L DVS+D 
Sbjct  642   PGIMLYLRAAQDINLSSGPSRTQYQYALRSSDSTQLALWAQRLTERLKQVPGLMDVSNDL  701

Query  724   DVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYA  783
              V    T L  D       G++   V  TL DAFGQRQV      +NQY VV+E+     
Sbjct  702   QVGASVTALDIDRVAAARFGLSAEDVSQTLYDAFGQRQVGEYQTEVNQYKVVLELDARQR  761

Query  784   QTVEALRGIYVQNN-AGQSIPLSTFSTWQAANTS-LSVNHQGLFAASTITFNLNPGYSLS  841
                E+L   Y+++  +G+ +PLS  +   A  +  L +NH G+F A  ++FNL  G SL 
Sbjct  762   GRAESLDWFYLRSPLSGEMVPLSAIAKVAAPRSGPLQINHNGMFPAVNLSFNLAAGVSLG  821

Query  842   DATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFA  901
             +A   + +A   + +PS++ G FQG+A+AFQ+SL+++PLLILAA+I +YI+LG+LYE F 
Sbjct  822   EAVQAVQRAQEEIGMPSTIIGVFQGAAQAFQSSLASQPLLILAALIAVYIILGVLYESFV  881

Query  902   HPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQ  961
             HPLTILSTLPSAG+GA+  L  +  +FS++ALIGI+LLIGIVKKN I+M+D A+  QR+Q
Sbjct  882   HPLTILSTLPSAGIGAVFLLWAWGQDFSIMALIGIVLLIGIVKKNGILMVDFAIVAQREQ  941

Query  962   KLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQI  1021
              +  E AI  A + RFRPI+MTTLAAL GA+PL +G G G+EL  PLG+++VGGL++SQ+
Sbjct  942   GMSAEQAIYQACLTRFRPIMMTTLAALLGAIPLMIGFGTGSELRQPLGIAVVGGLLVSQV  1001

Query  1022  LTLYSTPVMYLYIDQ-FSRWG  1041
             LTL+STPV+YL +++ F R G
Sbjct  1002  LTLFSTPVVYLALERLFHRRG  1022


> Q84GI8 Resistance-nodulation-cell division family efflux pump 
protein SdeD [Serratia marcescens]
Length=631

 Score =  513 bits (1322),  Expect = 2e-171
 Identities = 292/650 (45%), Positives = 396/650 (61%), Gaps = 29/650 (4%)

Query  400   VDDTIVVLETISRRIEEGLSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRL  459
             +DD IVV+E ISR IE+G  P+ AA+ GA E+ FT +S++ SL+AV +P+L MG IVGRL
Sbjct  1     MDDAIVVIENISRYIEKGEKPLDAALKGAGEIGFTTISLTFSLVAVLIPLLFMGDIVGRL  60

Query  460   FHEFAMTLTYAILISMLVSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEML  519
             F EFA+TL  AILIS +VSLT TPM+CA  L    +++        ER            
Sbjct  61    FREFAVTLAVAILISAVVSLTLTPMMCARMLSHESLRKQNRFSAASER------------  108

Query  520   LVASDDEYLKQQGLFGRMTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFP  579
                           F R+   Y R L   L +  +TL + + T+ L V LY+++PKGFFP
Sbjct  109   -------------FFERVIARYGRWLKTVLNHPWLTLGVAVGTLALTVLLYLLIPKGFFP  155

Query  580   QQDTGVMMGSLVADQNISFDAMNTKLKHDMAVIGKDPAVDHVMGTI----SGSQMNRANL  635
              QD G++ G+L A Q++SF  M  + +   A I KDPAV+ +   +    S + +N   L
Sbjct  156   VQDNGIIQGTLEALQSVSFSNMAERQQQVAAQILKDPAVESLTSFVCVDGSNATLNSGRL  215

Query  636   FLALKPLSERTDHPDQIMARLRKALKYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDD  695
              + LKPLSER+D    I++RL++      G +  L+PVQD+ +  + S   YQ+TLQ   
Sbjct  216   QINLKPLSERSDRIPAIISRLQQQTAQFPGVKLYLQPVQDLTIDTQVSRTQYQFTLQAMS  275

Query  696   LNTLRSWTPKIQAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLND  755
             L+ L  W P++   L + P L DV+SD   +GL   +  D D    LG+T S  D+ L +
Sbjct  276   LDDLSLWVPQLMDELKQTPQLADVTSDWQDRGLVAYVNVDRDSASRLGVTMSDADNALYN  335

Query  756   AFGQRQVSTIYNAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANT  815
             AFGQR +STIY   NQY VV+E        + AL  I +  N G  +PLS  +  +    
Sbjct  336   AFGQRLISTIYTQANQYRVVLEHDVSATPGLAALNEIRLSGNDGAVVPLSAIAKIEERFG  395

Query  816   SLSVNHQGLFAASTITFNLNPGYSLSDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASL  875
                  H   F ++T++FN+  GYSL +A   +  A   L +P  +   FQG+  AFQA+L
Sbjct  396   LPPRRHHEHFPSATVSFNVADGYSLGEAVDAVTLAEKNLNMPRDITTQFQGATLAFQAAL  455

Query  876   SAEPLLILAAIIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIG  935
              +   LILAA++ +YIVLG+LYE F HP+TILSTLP+AG+GAL+AL++   E  VIA+IG
Sbjct  456   GSTLWLILAAVVAMYIVLGVLYESFIHPVTILSTLPTAGVGALLALMMAGSELDVIAIIG  515

Query  936   ILLLIGIVKKNAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLA  995
             I+LLIGIVKKNAIMMID AL  +R+Q L P  AI  A +LR RPI+MTTLAAL GALPL 
Sbjct  516   IILLIGIVKKNAIMMIDFALAAEREQGLSPRDAICQACLLRLRPILMTTLAALLGALPLM  575

Query  996   LGRGDGAELHIPLGVSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRRKL  1045
             L  G GAEL  PLGV +VGGLI+SQILTL++TPV+YL  D+ +R   R+L
Sbjct  576   LSTGVGAELRHPLGVCMVGGLIMSQILTLFTTPVIYLLFDKLARNTHRQL  625


> Q6PKZ7 Efflux pump membrane transporter [Campylobacter coli]
Length=1040

 Score =  441 bits (1133),  Expect = 6e-139
 Identities = 305/1059 (29%), Positives = 520/1059 (49%), Gaps = 51/1059 (5%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPV  +++++ + L G +    LP+   P +  PT+ V+A   GA  + +A+TVA+P
Sbjct  6     FIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVKVSATYTGADAQTIASTVASP  65

Query  67    LERNLGRIAGVNEITS-ASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN  125
             +E  +     +  + S +SS GT  +T+ FD+  D + A  DV   I+A+ A +P  ++ 
Sbjct  66    IEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQATIDVNNRISAATAKMPDAVKK  125

Query  126   -NPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPA  184
                T RK + A    + +  +  ++S   +Y+     +  +L ++ GVGD N  G+   +
Sbjct  126   LGVTVRKTSSATLAAISMYSSDGSMSAVDVYNYITLNVLDELKRVPGVGDANAIGNRNYS  185

Query  185   VRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFV------EQKNQLWEVKANDQARQA  238
             +R+ L P  L  +GI    V SAI   NA    G +      ++   ++ +    + +  
Sbjct  186   LRIWLKPDLLNKFGITATDVISAINDQNAQYATGKIGEEPVTQKSPYVYSITMQGRLQSP  245

Query  239   ADFIPLIVSYKN-GAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETI  297
             ++F  +I+   N G+ +R+ DVA V+       + G      AV +M+  Q  AN + T 
Sbjct  246   SEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQGRLNGNDAVPIMINLQSGANALNTA  305

Query  298   QRIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGR  357
             + +   +  L +  P  +      D +K +  S++E+ +T + A++LVI+V+++FL+N R
Sbjct  306   KLVEAKMQELSKNFPKGLTYKIPYDTTKFVIESIKEVVKTFVEALILVIIVMYMFLKNFR  365

Query  358   ATLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEG  417
             ATLIP I VP+SL+GTF  +Y  GFS+N ++L AL +A G VVDD I+V+E I R + E 
Sbjct  366   ATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFALILAIGIVVDDAIIVVENIDRILHEN  425

Query  418   --LSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISM  475
               +S   AAI   +EVS  V+S+ + L AVFVP+  + G VG +  +FA+TL  ++ IS 
Sbjct  426   EQISVKDAAIQAMQEVSSPVISIVLVLCAVFVPVSFISGFVGEIQRQFALTLAISVTISG  485

Query  476   LVSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFG  535
              V+LT TP LCA +L+               R+E  P    +           K    F 
Sbjct  486   FVALTLTPSLCALFLR---------------RNEGEPFKFVK-----------KFNDFFD  519

Query  536   RMTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQN  595
               T ++   +A  L+     ++IF   +G   YLY  VP    P++D G+M+  +     
Sbjct  520   WSTSIFSAGVAYMLKRTIRFVLIFCIMLGAIFYLYKAVPNSLVPEEDQGLMISIINLPSA  579

Query  596   ISFDAMNTKLKHDMAVIGKDPAVDHVMGTI------SGSQMNRANLFLALKPLSERTDHP  649
              +     +++ H    + K   V   M  I      S  + N A +F+ L+   +R    
Sbjct  580   SALHRTISEVDHISQEVLKTNGVKDAMAMIGFDLFTSSLKENAAAMFIGLQDWKDRNVSA  639

Query  650   DQIMARLRKALKYE---AGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKI  706
             DQI+A L K   ++   +     L P+  +++ G      Y     G   + ++    K+
Sbjct  640   DQIIAELNKKFAFDRNASSVFIGLPPIPGLSITG--GFEMYVQNKSGKSYDQIQEDVNKL  697

Query  707   QAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIY  766
              AA ++   L  V +  D    + KLI D DK+K   +    V ST+N   G   V+   
Sbjct  698   VAAANQREELYGVRTTLDTSFPQYKLIIDRDKLKHFNLNMQDVFSTMNATIGTYYVNDFT  757

Query  767   NAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFA  826
                  + V +    ++  T +AL+ I+V++N G+ IPL +F T Q ++    V    LF 
Sbjct  758   MLGKNFQVNIRAKGDFRNTQDALKNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNLFP  817

Query  827   ASTITFNLNPGYSLSDATVQINQ-AMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAA  885
             A+ +     PGY+   A   I Q A   L    S+  ++ GSA    +S           
Sbjct  818   AAQVQGQPAPGYTSGQAIEAIAQVAKETLGDDYSI--AWSGSAYQEVSSKGTASYAFALG  875

Query  886   IIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKK  945
             +I ++++L   YE +  PL +++ +P A  G+ + + L      +    G+LLLIG+  K
Sbjct  876   MIFVFLILAAQYERWLIPLAVVTAVPFAVFGSFLLVYLRGFSNDIYFQTGLLLLIGLSAK  935

Query  946   NAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELH  1005
             NAI++++ A+  + ++      A + A+ LRFRPIIMT+LA  FG LP+    G G+   
Sbjct  936   NAILIVEFAMEERFKKGKGVFEAAVAAAKLRFRPIIMTSLAFTFGVLPMIFATGAGSASR  995

Query  1006  IPLGVSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRRK  1044
               LG  ++GG+I +  L ++  P+ +  ++ F+ W  +K
Sbjct  996   HSLGTGLIGGMIAASTLAIFFVPLFFYLLENFNEWLDKK  1034


> Q8RTE4 Efflux pump membrane transporter [Campylobacter jejuni]
Length=1040

 Score =  438 bits (1126),  Expect = 6e-138
 Identities = 302/1059 (29%), Positives = 521/1059 (49%), Gaps = 51/1059 (5%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPV  +++++ + L G +    LP+   P +  PT+ V+A   GA  + +A+TVA+P
Sbjct  6     FIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVKVSATYTGADAQTIASTVASP  65

Query  67    LERNLGRIAGVNEITS-ASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN  125
             +E  +     +  + S +SS GT  +T+ FD+  D + A  DV   I+A+ A +P  ++ 
Sbjct  66    IEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQATIDVNNRISAATAKMPDAVKK  125

Query  126   -NPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPA  184
                T RK +      + +  +  ++S   +Y+     +  +L ++ GVGD N  G+   +
Sbjct  126   LGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNVLDELKRVPGVGDANAIGNRNYS  185

Query  185   VRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFV------EQKNQLWEVKANDQARQA  238
             +R+ L P  L  +GI    V SA+   NA    G +      ++   ++ +    + +  
Sbjct  186   LRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIGEEPVTQKSPYVYSITMQGRLQNP  245

Query  239   ADFIPLIVSYKN-GAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETI  297
             ++F  +I+   N G+ +R+ DVA V+       + G      AV +M+  Q  AN + T 
Sbjct  246   SEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQGRLNGNDAVPIMINLQSGANALHTA  305

Query  298   QRIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGR  357
             + ++  +  L +  P  +      D +K +  S++E+ +T + A++LVI+V+++FL+N R
Sbjct  306   ELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIKEVVKTFVEALILVIIVMYMFLKNFR  365

Query  358   ATLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEG  417
             ATLIP I VP+SL+GTF  +Y  GFS+N ++L AL +A G VVDD I+V+E I R + E 
Sbjct  366   ATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFALILAIGIVVDDAIIVVENIDRILHEN  425

Query  418   --LSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISM  475
               +S   AAI   +EVS  V+S+ + L AVFVP+  + G VG +  +FA+TL  ++ IS 
Sbjct  426   EQISVKDAAIQAMQEVSSPVISIVLVLCAVFVPVSFISGFVGEIQRQFALTLAISVTISG  485

Query  476   LVSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFG  535
              V+LT TP LCA +L+               R+E  P    +           K    F 
Sbjct  486   FVALTLTPSLCALFLR---------------RNEGEPFKFVK-----------KFNDFFD  519

Query  536   RMTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQN  595
               T ++   +A  L+     ++IF   +G   YLY  VP    P++D G+M+  +     
Sbjct  520   WSTSVFSAGVAYILKRTIRFVLIFCIMLGAIFYLYKAVPNSLVPEEDQGLMISIINLPSA  579

Query  596   ISFDAMNTKLKHDMAVIGKDPAVDHVMGTI------SGSQMNRANLFLALKPLSERTDHP  649
              +     +++ H    + K   V   M  I      S  + N A +F+ L+   +R    
Sbjct  580   SALHRTISEVDHISQEVLKTNGVKDAMAMIGFDLFTSSLKENAAAMFIGLQDWKDRNVSA  639

Query  650   DQIMARLRKALKYE---AGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKI  706
             DQI+A L K   ++   +     L P+  +++ G      Y     G   + ++    K+
Sbjct  640   DQIIAELNKKFAFDRNASSVFIGLPPIPGLSITG--GFEMYVQNKSGKSYDEIQKDVNKL  697

Query  707   QAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIY  766
              AA ++   L+ V +  D    + KLI D DK+K   +    V +T+N   G   V+   
Sbjct  698   VAAANQRKELSRVRTTLDTTFPQYKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYVNDFS  757

Query  767   NAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFA  826
                  + V +    ++  T +AL+ I+V++N G+ IPL +F T Q ++    V    LF 
Sbjct  758   MLGKNFQVNIRAKGDFRNTQDALKNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNLFP  817

Query  827   ASTITFNLNPGYSLSDATVQINQ-AMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAA  885
             A+ +     PGY+   A   I Q A   L    S+  ++ GSA    +S           
Sbjct  818   AAQVQGQPAPGYTSGQAIEAIAQVAKETLGDDYSI--AWSGSAYQEVSSKGTASYAFALG  875

Query  886   IIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKK  945
             +I ++++L   YE +  PL +++ +P A  G+ + + L      +    G+LLLIG+  K
Sbjct  876   MIFVFLILAAQYERWLIPLAVVTAVPFAVFGSFLLVYLRGFSNDIYFQTGLLLLIGLSAK  935

Query  946   NAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELH  1005
             NAI++++ A+  + ++      A + A+ LRFRPIIMT+LA  FG LP+    G G+   
Sbjct  936   NAILIVEFAMEERFKKGKGVFEAAVAAAKLRFRPIIMTSLAFTFGVLPMIFATGAGSASR  995

Query  1006  IPLGVSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRRK  1044
               LG  ++GG+I +  L ++  P+ +  ++ F+ W  +K
Sbjct  996   HSLGTGLIGGMIAASTLAIFFVPLFFYLLENFNEWLDKK  1034


> Q0PBE4 Efflux pump membrane transporter [Campylobacter jejuni 
subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)]
Length=1040

 Score =  436 bits (1122),  Expect = 2e-137
 Identities = 301/1059 (28%), Positives = 518/1059 (49%), Gaps = 51/1059 (5%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPV  +++++ + L G +    LP+   P +  PT+ V+A   GA  + +A+TVA+P
Sbjct  6     FIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVKVSATYTGADAQTIASTVASP  65

Query  67    LERNLGRIAGVNEITS-ASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN  125
             +E  +     +  + S +SS GT  +T+ FD+  D + A  DV   I+A+ A +P  ++ 
Sbjct  66    IEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQATIDVNNRISAATAKMPDAVKK  125

Query  126   -NPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPA  184
                T RK +      + +  +  ++S   +Y+     +  +L ++ GVGD N  G+   +
Sbjct  126   LGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNVLDELKRVPGVGDANAIGNRNYS  185

Query  185   VRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFV------EQKNQLWEVKANDQARQA  238
             +R+ L P  L  +GI    V SA+   NA    G +      ++   ++ +    + +  
Sbjct  186   LRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIGEEPVTQKSPYVYSITMQGRLQNP  245

Query  239   ADFIPLIVSYKN-GAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETI  297
             ++F  +I+   N G+ +R+ DVA V+       + G      AV +M+  Q  AN + T 
Sbjct  246   SEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQGRLNGNDAVPIMINLQSGANALHTA  305

Query  298   QRIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGR  357
             + ++  +  L +  P  +      D +K +  S++E+ +T + A++LVI+V+++FL+N R
Sbjct  306   ELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIKEVVKTFVEALILVIIVMYMFLKNFR  365

Query  358   ATLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEG  417
             ATLIP I VP+SL+GTF  +Y  GFS+N ++L AL +A G VVDD I+V+E I R + E 
Sbjct  366   ATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFALILAIGIVVDDAIIVVENIDRILHEN  425

Query  418   --LSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISM  475
               +S   AAI   +EVS  V+S+ + L AVFVP+  + G VG +  +FA+TL  ++ IS 
Sbjct  426   EQISVKDAAIQAMQEVSSPVISIVLVLCAVFVPVSFISGFVGEIQRQFALTLAISVTISG  485

Query  476   LVSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFG  535
              V+LT TP LCA +L+               R+E  P    +           K    F 
Sbjct  486   FVALTLTPSLCALFLR---------------RNEGEPFKFVK-----------KFNDFFD  519

Query  536   RMTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQN  595
               T ++   +A  L+     ++IF   +G   YLY  VP    P++D G+M+G +     
Sbjct  520   WSTSVFSAGVAYILKRTIRFVLIFCIMLGAIFYLYKAVPSSLVPEEDQGLMIGIINLPSA  579

Query  596   ISFDAMNTKLKHDMAVIGKDPAVDHVMGTI------SGSQMNRANLFLALKPLSERTDHP  649
              +     +++ H    + K   V   M  I      S  + N A +F+ LK   +R    
Sbjct  580   SALHRTISEVDHISQEVLKTNGVKDAMAMIGFDLFTSSLKENAAAMFIGLKDWKDRNVSA  639

Query  650   DQIMARLRKALKYEAGTR---FTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKI  706
             D+I   L K   ++         L P+  +++ G      Y     G   + ++    K+
Sbjct  640   DEIAMELNKKFAFDRNASSIFIGLPPIPGLSITG--GFEMYVQNKSGKSYDEIQKDVNKL  697

Query  707   QAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIY  766
              A  ++   L+ V +  D    + KLI D DK+K   +    V +T+N   G   V+   
Sbjct  698   VAVANQRKELSRVRTTLDTTFPQYKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYVNDFS  757

Query  767   NAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFA  826
                  + V +    ++  T +AL+ I+V++N G+ IPL +F T Q ++    V    LF 
Sbjct  758   MLGKNFQVNIRAKGDFRNTQDALKNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNLFP  817

Query  827   ASTITFNLNPGYSLSDATVQINQ-AMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAA  885
             A+ +     PGY+   A   I Q A   L    S+  ++ GSA    +S           
Sbjct  818   AAQVQGQPAPGYTSGQAIEAIAQVAKETLGDDYSI--AWSGSAYQEVSSKGTASYAFALG  875

Query  886   IIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKK  945
             +I ++++L   YE +  PL +++ +P A  G+ + + L      +    G+LLLIG+  K
Sbjct  876   MIFVFLILAAQYERWLIPLAVVTAVPFAVFGSFLLVYLRGFSNDIYFQTGLLLLIGLSAK  935

Query  946   NAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELH  1005
             NAI++++ A+  + ++      A + A+ LRFRPIIMT+LA  FG LP+    G G+   
Sbjct  936   NAILIVEFAMEERFKKGKGVFEAAVAAAKLRFRPIIMTSLAFTFGVLPMIFATGAGSASR  995

Query  1006  IPLGVSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRRK  1044
               LG  ++GG+I +  L ++  P+ +  ++ F+ W  +K
Sbjct  996   HSLGTGLIGGMIAASTLAIFFVPLFFYLLENFNEWLDKK  1034


> A6P7G9 Multidrug efflux transporter VexB [Vibrio cholerae]
Length=1026

 Score =  436 bits (1120),  Expect = 3e-137
 Identities = 291/1036 (28%), Positives = 499/1036 (48%), Gaps = 44/1036 (4%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             M  +  FI+RPV    +S  +VLLG+ A   + V   P +    I+V+    GAS +++ 
Sbjct  1     MRFTDVFIKRPVLAVSISFLIVLLGLQAIFKMQVREYPEMTNTVITVSTGYYGASADLIQ  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
               +  PLE+ + +   ++ +TS S LG + IT+   LN D N A  DV    N+  + LP
Sbjct  61    GFITQPLEQAVAQADNIDFMTSQSVLGRSTITVTMKLNTDPNAALSDVLAKTNSVRSQLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
                ++ PT   +  +   ++ +  TS  L+  QI D  + ++  +L  ++GV  +++ G 
Sbjct  121   KEAED-PTVTMSTGSTTAVLYIGFTSNELASSQITDYLERVVNPQLYAVNGVSSIDLYGG  179

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
              + A+RV L+P+++A   +    V S + + N     G    +  L+   A+ Q     D
Sbjct  180   MKYALRVWLDPAKMAALNLSAADVMSILNANNYQSATGQAIGEFVLYNGSADTQVSTVED  239

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
                L+V  + G   R+ D+A+V  +            + AV+  +   P+AN I   + +
Sbjct  240   LESLVVKAEKGTVTRLGDIAKVTLA----------NGREAVVAAINAAPSANPINIAKDV  289

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
              + LP LQ+ +PS IE++   D +  I  S+ E+ +T++ A ++V++V+ +FL + RA L
Sbjct  290   LEMLPELQKNMPSNIEMNVLYDSTVAINESIHEVIKTIVEAALIVLVVITLFLGSLRAVL  349

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IP +T+P+SLIG   +M   GFS N ++L+A+ +A G VVDD IVVLE + R I+EG SP
Sbjct  350   IPIVTIPLSLIGVAMVMQMMGFSWNLMTLLAMVLAIGLVVDDAIVVLENVDRHIKEGESP  409

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
              +AAI G +E++  V++M+++L AV+ PI LMGGI G LF EFA+TL  ++ +S +V+LT
Sbjct  410   FRAAIIGTREIAIPVIAMTLTLGAVYAPIALMGGITGSLFKEFALTLAGSVFVSGIVALT  469

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
              +PM+C+  LK+ +                           A +   LK   L  RMT  
Sbjct  470   LSPMMCSKMLKANE---------------------------APNKFELKVHHLLDRMTAR  502

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             Y+R L   + ++ + +            L+  +P    P +D GV+M       N + D 
Sbjct  503   YERMLTAVMAHRPVVIAFAFIVFASLPMLFKFIPSELAPSEDKGVIMLMGTGPSNANLDY  562

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             +   +     ++   P V            N+A    ++ P S+R      +  R+   +
Sbjct  563   LANTMDDVNKILSDQPEVQFAQVFTGVPNSNQAFGIASMVPWSQREASQATVTNRVGTLV  622

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
             +   G   T   + ++   G      +  T    +  +L +    +   +   P      
Sbjct  623   QDIPGMAVTAFQMPELPGAGSGLPIQFVITTP-SNFESLFTIATDVLTEVKANPMFVYSD  681

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
              D +      K+  D DK  + G+T   +  TL+       V+ I      Y V+ +V  
Sbjct  682   LDLNFDSATMKINIDKDKAGAYGVTMQDIGITLSTMMADGYVNRIDLNGRSYEVIPQVER  741

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
             ++    E++   YV+   G+ IPL +  T        S+ H     ++T+     PG ++
Sbjct  742   KWRLNPESMNSYYVRAADGKVIPLGSLVTIDVVAEPRSLPHFNQLNSATVGAVPAPGTAM  801

Query  841   SDATVQINQAMNLL--QVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYE  898
              DA   IN   NL   ++P      + G A+ +    SA       A+ +I++VL I +E
Sbjct  802   GDA---INWFENLASSKLPKGYSHDYMGEARQYVTEGSALYATFGLALAIIFLVLAIQFE  858

Query  899   DFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQ  958
                 PL I+ ++P A  GALIAL       ++ + +G++ L+G++ K+ I++ +VA   Q
Sbjct  859   SLRDPLVIMVSVPLAICGALIALAWSTATMNIYSQVGLITLVGLITKHGILICEVAKEEQ  918

Query  959   RQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLII  1018
                KL    A++ A+ +R RPI+MTT A + G +PL    G GA     +G+ IV GL I
Sbjct  919   LHNKLSRIEAVMHAAKVRLRPILMTTAAMIAGLIPLMYATGAGAAQRFSIGIVIVSGLAI  978

Query  1019  SQILTLYSTPVMYLYI  1034
               + TL+  PV+Y Y+
Sbjct  979   GTLFTLFVLPVIYSYL  994


> Q1A4H5 Efflux pump membrane transporter [Campylobacter coli]
Length=1040

 Score =  432 bits (1110),  Expect = 1e-135
 Identities = 295/1059 (28%), Positives = 523/1059 (49%), Gaps = 51/1059 (5%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPV  +++++ + L G +    LP+   P +  PT+ V+A   GA  + +A TVA P
Sbjct  6     FIERPVFASVVAIIISLAGAIGLVNLPIEQYPSLTPPTVKVSATYTGADAQTIATTVANP  65

Query  67    LERNLGRIAGVNEITS-ASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN  125
             +E  +     +  + S +SS GT  +T+ F++  D + A  DV   I+A+ A +P  ++ 
Sbjct  66    IEDAINGADNMIYMDSTSSSSGTMNLTVYFNIGTDPDQATIDVNNRISAATAKMPDEVKK  125

Query  126   -NPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPA  184
                T RK +      + +  ++ ++S   +Y+     +  +L ++ GVGD N  G+   +
Sbjct  126   LGVTVRKTSSTTLAAISMYSSNGSMSAVDVYNYITLNILDELKRVPGVGDANAIGNRNYS  185

Query  185   VRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFV------EQKNQLWEVKANDQARQA  238
             +R+ L P  L  +G     V +A+   NA    G +      ++   ++ +    + +  
Sbjct  186   LRIWLKPDLLNKFGATATDVIAAVNDQNAQYATGKIGEEPVTQKSPYVYSITMQGRLQSP  245

Query  239   ADFIPLIV-SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETI  297
             ++F  +I+ + ++G+ +R+ DVA V+       + G      AV +M+  Q  AN + T 
Sbjct  246   SEFENIILRTNEDGSFLRLKDVADVEIGSQQYKSQGRLNGNDAVPIMINLQSGANALNTA  305

Query  298   QRIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGR  357
             + +   +  L ++ P  +E     D +K +  S++E+ +T + A++LVI+V+++FL+N R
Sbjct  306   KLVEAKMQELSKSFPEGLEYKIPYDTTKFVIESIKEVIKTFVEALILVIIVMYMFLKNFR  365

Query  358   ATLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRI--E  415
             +TLIP I VP+SL+GTF  +Y  GFS+N ++L AL +A G VVDD I+V+E I R +  +
Sbjct  366   STLIPMIAVPVSLLGTFAGLYLLGFSINLLTLFALILAIGIVVDDAIIVVENIDRILHED  425

Query  416   EGLSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISM  475
             E +S   AAI   +EVS  V+S+ + L AVF+P+  + G VG +  +FA+TL  ++ IS 
Sbjct  426   EKISVKDAAIQAMQEVSSPVISIVLVLCAVFIPVSFISGFVGEIQRQFALTLAISVTISG  485

Query  476   LVSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFG  535
              V+LT TP LCA +L+               R+E  P    +           K    F 
Sbjct  486   FVALTLTPSLCALFLR---------------RNEGEPFKFVK-----------KFNDFFD  519

Query  536   RMTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQN  595
               T ++   +A  L+     ++IF   +G   YLY  VP    P++D  +M+  +     
Sbjct  520   WSTSVFSAGVAYILKRTIRFVLIFCIMLGAIFYLYKAVPNSLVPEEDQSLMISIINLPSA  579

Query  596   ISFDAMNTKLKHDMAVIGKDPAVDHVMGTI------SGSQMNRANLFLALKPLSERTDHP  649
              +     +++ H    + K   V   M  I      S  + N A +F+ L+   +R    
Sbjct  580   SALHRTISEVDHISQEVLKTNGVKDAMAMIGFDLFTSSLKENAAAMFIGLQDWKDRNVSA  639

Query  650   DQIMARLRKALKYE---AGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKI  706
             DQI+A L K   ++   +     L P+  +++ G      Y     G   + ++    K+
Sbjct  640   DQIIAELNKKFAFDRNASSVFIGLPPIPGLSITG--GFEMYVQNKSGKSYDQIQEDVNKL  697

Query  707   QAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIY  766
              AA ++   L  V +  D    + KLI D DK+K   +    V ST+N   G   V+   
Sbjct  698   VAAANQREELYGVRTTLDTSFPQYKLIIDRDKLKHFNLNMQDVFSTMNATIGTYYVNDFT  757

Query  767   NAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFA  826
                 ++ V +    ++  T  AL+ I+V++N G+ IPL +F T Q ++    V    +F 
Sbjct  758   MLGKKFQVNIRAKGDFINTQNALKNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNIFP  817

Query  827   ASTITFNLNPGYSLSDATVQINQ-AMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAA  885
             A+ I     PGY+   A   I+Q A   L    S+  ++ GSA    +S           
Sbjct  818   AAQIQGQPAPGYTSGQAIEAISQVAQETLSDDYSI--AWSGSAYQEVSSKGTGSYAFALG  875

Query  886   IIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKK  945
             ++ ++++L   YE +  PL +++ +P A  G+ + + L      +    G+LLLIG+  K
Sbjct  876   MVFVFLILAAQYERWLIPLAVVTAVPFAVFGSFLLVYLRGFTNDIYFQTGLLLLIGLSAK  935

Query  946   NAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELH  1005
             NAI++++ A+  + ++      A ++A+ LRFRPI+MT+LA  FG LP+    G G+   
Sbjct  936   NAILIVEFAMEERFKKGKKIFDAAIEAAKLRFRPIVMTSLAFTFGVLPMIFATGAGSASR  995

Query  1006  IPLGVSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRRK  1044
               LG  ++GG+I +  L ++  P+ +  ++ F+ W  +K
Sbjct  996   HSLGTGLIGGMIAASTLAIFFVPLFFYLLENFNEWLDKK  1034


> Q1A4H7 Efflux pump membrane transporter [Campylobacter jejuni]
Length=1039

 Score =  427 bits (1099),  Expect = 4e-134
 Identities = 305/1069 (29%), Positives = 530/1069 (50%), Gaps = 72/1069 (7%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPV  +++++ + + GI+    LPV   P +  PT+ V+A   GA  + +A+TVATP
Sbjct  6     FIERPVFASVVAIIISIAGIIGLANLPVEQYPSLTPPTVQVSATYTGADAQTIASTVATP  65

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN-  125
             +E  +  +  +  + S SS G  ++T+ F++  D + AA DV   I+A+ A LP  ++  
Sbjct  66    IEDAINGVDNMIYMDSTSSPGQMKLTVYFNIGTDPDQAAIDVNNRISAATAKLPEAVKKL  125

Query  126   NPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAV  185
               T RK++     ++ +     +++   IY+     +  +L +I GVGD +  G+   ++
Sbjct  126   GVTVRKSSSTILEVVSVYSEDSSMNDIDIYNYVSLNILDELKRIPGVGDASAIGNKNYSM  185

Query  186   RVELNPSQLAHYGIGLDAVRSAITSTNANRPKG------FVEQKNQLWEVKANDQARQAA  239
             R+ L P  L  +G+  + V +A+   NA    G       V +  Q+  +    + +   
Sbjct  186   RIWLEPDLLNKFGVTANDVINAVNDQNAQYATGKIGEEPVVNKSPQVISITMQGRLQTPQ  245

Query  240   DFIPLIVSYKNGAA-IRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQ  298
             +F  +I+      + +RI DVA+V+      ++ G      AV +M+  Q  AN + T +
Sbjct  246   EFENIILRVNEDKSFLRIKDVAKVEIGAEQYNSTGRLNTSAAVPIMINLQSGANAVNTAK  305

Query  299   RIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRA  358
              I + +  L +  P  ++     D +  ++AS++E+ +T + A+ LV++V+++FL+N ++
Sbjct  306   LINEKMQELSKNFPQGLKYQIPYDTTIFVKASIKEVIKTFVEALALVLVVMYLFLKNFKS  365

Query  359   TLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEE--  416
             T+IP I VP+SL+GTF ++Y  GFS+N ++L AL +A G VVDD I+V+E I R + E  
Sbjct  366   TIIPMIAVPVSLLGTFAVLYVLGFSINLLTLFALVLAIGIVVDDAIIVVENIDRILHEDS  425

Query  417   GLSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISML  476
              +S   AAI    EVS  V+S+ + L AVF+P+  + G VG +  +FA+TL  ++ IS  
Sbjct  426   NISVKDAAIKAMNEVSSPVISIVLVLCAVFIPVSFISGFVGEIQRQFALTLAISVAISGF  485

Query  477   VSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGR  536
             V+LT TP L A               L + R+E+ P    +           K    F  
Sbjct  486   VALTLTPSLSA---------------LFLTRNESKPFYFIQ-----------KFNDFFDW  519

Query  537   MTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMM-------GS  589
              T ++   +A  L+     +++F   IG   YL+ +VP    P +D GV+M       GS
Sbjct  520   STSVFSSGVAYILKRTIRFVLVFCIMIGFIAYLFKIVPSSLVPSEDQGVIMSIINLPSGS  579

Query  590   LVADQNISFDAMN---TKLKH---DMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLS  643
              +       D +N   T++K     +++IG D          S  + N A +F  LK  S
Sbjct  580   SIHRTIEEVDTINKNATQMKEISSSVSLIGFDLFT-------SSLKENAAAVFFKLKDWS  632

Query  644   ERTDHPDQIMARL-------RKALKYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDL  696
             +R    DQI+A+L       R AL Y       L P+  +++ G      Y     G D 
Sbjct  633   QREASSDQIIAQLFGQYAADRNALSY----FLNLPPIPGLSLTG--GFEMYAQNKSGKDY  686

Query  697   NTLRSWTPKIQAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDA  756
             + ++    K+         L +V +  D    + KLI D DKMK   +    V +T++  
Sbjct  687   DAIQQDVNKMLELARTRKELANVRTTLDTSFPQYKLIIDRDKMKYYNLNMQDVFNTISAT  746

Query  757   FGQRQVSTIYNAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTS  816
              G   V+        + V +    ++  T +AL+ IY++++  + IPL++F T   +   
Sbjct  747   IGTYYVNDFPMLGKNFQVNIRALGDFRNTQDALKNIYIRSSDNKMIPLNSFLTLVRSAGP  806

Query  817   LSVNHQGLFAASTITFNLNPGYSLSDATVQINQ-AMNLLQVPSSVRGSFQGSAKAFQASL  875
               V    LF A+ I  +  PGY+   A   I + A   L    S+  ++ GSA    +S 
Sbjct  807   DDVKRFNLFPAALIQGDPVPGYTSGQAIDAIAEVAKQSLGDEYSI--AWSGSAYQEVSSK  864

Query  876   SAEPLLILAAIIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIG  935
              A     +  +I ++++L   YE +  PL +++ +P A  G+++ + L   +  +    G
Sbjct  865   GAGAYAFVLGMIFVFLILAAQYERWLMPLAVITAVPFAVFGSILLVALRGFDNDIYFQTG  924

Query  936   ILLLIGIVKKNAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLA  995
             +LLLIG+  KNAI++I+ A+  + ++      A ++A+ LRFRPI+MT+LA  FG LP+ 
Sbjct  925   LLLLIGLSAKNAILIIEFAMEERLKKGKSIFEAAINAAKLRFRPIVMTSLAFTFGVLPMI  984

Query  996   LGRGDGAELHIPLGVSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRRK  1044
                G G+     LG  +VGG+I +  L ++  P+ +  ++ F+ W  +K
Sbjct  985   FATGAGSASRHSLGTGLVGGMIAASTLAIFFVPLFFYLLENFNEWLDKK  1033


> A0A1C9A1J1 Efflux pump membrane transporter [Campylobacter jejuni]
Length=1039

 Score =  426 bits (1095),  Expect = 2e-133
 Identities = 303/1069 (28%), Positives = 530/1069 (50%), Gaps = 72/1069 (7%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RP+  +++++ + + GI+    LPV   P +  PT+ V+A   GA  + +A+TVATP
Sbjct  6     FIERPIFASVVAIIISIAGIIGLANLPVEQYPSLTPPTVQVSATYTGADAQTIASTVATP  65

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN-  125
             +E  +  +  +  + S SS G  ++T+ F++  D + AA DV   I+A+ A LP  ++  
Sbjct  66    IEDAINGVDNMIYMDSTSSPGQMKLTVYFNIGTDPDQAAIDVNNRISAATAKLPEAVKKL  125

Query  126   NPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAV  185
               T RK++     ++ +     +++   IY+     +  +L +I GVGD +  G+   ++
Sbjct  126   GVTVRKSSSTILEVVSVYSEDSSMNDIDIYNYVSLNILDELKRIPGVGDASAIGNKNYSM  185

Query  186   RVELNPSQLAHYGIGLDAVRSAITSTNANRPKG------FVEQKNQLWEVKANDQARQAA  239
             R+ L P  L  +G+  + V +A+   NA    G       V +  Q+  +    + +   
Sbjct  186   RIWLEPDLLNKFGVTANDVINAVNDQNAQYATGKIGEEPVVNKSPQVISITMQGRLQTPQ  245

Query  240   DFIPLIVSYKNGAA-IRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQ  298
             +F  +I+      + +RI DVA+V+      ++ G      AV +++  Q  AN + T +
Sbjct  246   EFENIILRVNEDKSFLRIKDVAKVEIGAEQYNSTGRLNTSAAVPIIINLQSGANAVNTAK  305

Query  299   RIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRA  358
              I + +  L +  P  ++     D +  ++AS++E+ +T + A+ LV++V+++FL+N ++
Sbjct  306   LINEKMQELSKNFPQGLKYQIPYDTTIFVKASIKEVIKTFVEALALVLVVMYLFLKNFKS  365

Query  359   TLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEE--  416
             T+IP I VP+SL+GTF ++Y  GFS+N ++L AL +A G VVDD I+V+E I R + E  
Sbjct  366   TIIPMIAVPVSLLGTFAVLYVLGFSINLLTLFALVLAIGIVVDDAIIVVENIDRILHEDS  425

Query  417   GLSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISML  476
              +S   AAI    EVS  V+S+ + L AVF+P+  + G VG +  +FA+TL  ++ IS  
Sbjct  426   NISVKDAAIKAMNEVSSPVISIVLVLCAVFIPVSFISGFVGEIQRQFALTLAISVAISGF  485

Query  477   VSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGR  536
             V+LT TP L A               L + R+E+ P    +           K    F  
Sbjct  486   VALTLTPSLSA---------------LFLTRNESKPFYFIQ-----------KFNDFFDW  519

Query  537   MTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMM-------GS  589
              T ++   +A  L+     +++F   IG   YL+ +VP    P +D GV+M       GS
Sbjct  520   STSVFSSGVAYILKRTIRFVLVFCIMIGFIAYLFKIVPSSLVPSEDQGVIMSIINLPSGS  579

Query  590   LVADQNISFDAMN---TKLKH---DMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLS  643
              +       D +N   T++K     +++IG D          S  + N A +F  LK  S
Sbjct  580   SIHRTIEEVDTINKNATQMKEISSSVSLIGFDLFT-------SSLKENAAAVFFILKDWS  632

Query  644   ERTDHPDQIMARL-------RKALKYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDL  696
             +R    DQI+A+L       R AL Y       L P+  +++ G      Y     G D 
Sbjct  633   QREASSDQIIAQLFGQYAADRNALSY----FLNLPPIPGLSLTG--GFEMYAQNKSGKDY  686

Query  697   NTLRSWTPKIQAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDA  756
             + ++    K+         L +V +  D    + KLI D DKMK   +    V +T++  
Sbjct  687   DAIQQDVNKMLELARTRKELANVRTTLDTSFPQYKLIIDRDKMKYYNLNMQDVFNTISAT  746

Query  757   FGQRQVSTIYNAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTS  816
              G   V+        + V +    ++  T +AL+ IY++++  + IPL++F T   +   
Sbjct  747   IGTYYVNDFPMLGKNFQVNIRALGDFRNTQDALKNIYIRSSDNKMIPLNSFLTLVRSAGP  806

Query  817   LSVNHQGLFAASTITFNLNPGYSLSDATVQINQ-AMNLLQVPSSVRGSFQGSAKAFQASL  875
               V    LF A+ I  +  PGY+   A   I + A   L    S+  ++ GSA    +S 
Sbjct  807   DDVKRFNLFPAALIQGDPAPGYTSGQAIDAIAEVAKQSLGDEYSI--AWSGSAYQEVSSK  864

Query  876   SAEPLLILAAIIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIG  935
              A     +  +I ++++L   YE +  PL +++ +P A  G+++ + L   +  +    G
Sbjct  865   GAGAYAFVLGMIFVFLILAAQYERWLMPLAVITAVPFAVFGSILLVALRGFDNDIYFQTG  924

Query  936   ILLLIGIVKKNAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLA  995
             +LLLIG+  KNAI++I+ A+  + ++      A ++A+ LRFRPIIMT+LA  FG LP+ 
Sbjct  925   LLLLIGLSAKNAILIIEFAMEERLKKGKSIFEAAINAAKLRFRPIIMTSLAFTFGVLPMI  984

Query  996   LGRGDGAELHIPLGVSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRRK  1044
                G G+     LG  ++GG+I +  L ++  P+ +  ++ F+ W  +K
Sbjct  985   FATGAGSASRHSLGTGLIGGMIAASTLAIFFVPLFFYLLENFNEWLDKK  1033



Lambda      K        H        a         alpha
   0.322    0.136    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 18085509


  Database: 9e018d00625a483160fc8beb144e283b.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:13 PM
  Number of letters in database: 19,467
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40