ACIAD3422 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 581623e8e51508e72263c97c269ab497.SwissProt.fasta
           28 sequences; 28,852 total letters



Query= ACIAD3422

Length=1059
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  B2K9M1 Multidrug resistance protein MdtC [Yersinia pseudotuberc...  1161    0.0   
  B1JSD3 Multidrug resistance protein MdtC [Yersinia pseudotuberc...  1161    0.0   
  A7FG16 Multidrug resistance protein MdtC [Yersinia pseudotuberc...  1160    0.0   
  Q668C5 Multidrug resistance protein MdtC [Yersinia pseudotuberc...  1160    0.0   
  Q1C5L9 Multidrug resistance protein MdtC [Yersinia pestis bv. A...  1159    0.0   
  Q8ZCV9 Multidrug resistance protein MdtC [Yersinia pestis]          1159    0.0   
  A9QZU8 Multidrug resistance protein MdtC [Yersinia pestis bv. A...  1159    0.0   
  Q1CK61 Multidrug resistance protein MdtC [Yersinia pestis bv. A...  1159    0.0   
  A1JKW9 Multidrug resistance protein MdtC [Yersinia enterocoliti...  1154    0.0   
  A6TBH5 Multidrug resistance protein MdtC [Klebsiella pneumoniae...  1150    0.0   
  B5XPB8 Multidrug resistance protein MdtC [Klebsiella pneumoniae...  1150    0.0   
  A7ZNP9 Multidrug resistance protein MdtC [Escherichia coli O139...  1146    0.0   
  Q1R9Z5 Multidrug resistance protein MdtC [Escherichia coli (str...  1146    0.0   
  B7UTB4 Multidrug resistance protein MdtC [Escherichia coli O127...  1146    0.0   
  Q0TG14 Multidrug resistance protein MdtC [Escherichia coli O6:K...  1145    0.0   
  Q3Z0C8 Multidrug resistance protein MdtC [Shigella sonnei (stra...  1145    0.0   
  Q8FG03 Multidrug resistance protein MdtC [Escherichia coli O6:H...  1145    0.0   
  P76399 Multidrug resistance protein MdtC [Escherichia coli (str...  1144    0.0   
  A7MHJ0 Multidrug resistance protein MdtC [Cronobacter sakazakii...  1144    0.0   
  D4I6V4 Multidrug resistance protein MdtC [Erwinia amylovora (st...  1122    0.0   
  F2EYE0 Multidrug resistance protein MdtC [Pantoea ananatis (str...  1121    0.0   
  D0ZEW1 Multidrug resistance protein MdtB [Edwardsiella tarda (s...   873    0.0   
  P76398 Multidrug resistance protein MdtB [Escherichia coli (str...   869    0.0   
  D0JNB0 Multidrug resistance protein MdtB [Yersinia pestis (stra...   869    0.0   
  Q8G2M6 Efflux pump membrane transporter BepE [Brucella suis bio...   443    1e-139
  P25197 Nodulation protein NolG [Rhizobium meliloti (strain 1021)]    438    1e-137
  P24177 Probable aminoglycoside efflux pump [Escherichia coli (s...   386    9e-119
  P52002 Multidrug resistance protein MexB [Pseudomonas aeruginos...   384    7e-118


> B2K9M1 Multidrug resistance protein MdtC [Yersinia pseudotuberculosis 
serotype IB (strain PB1/+)]
Length=1024

 Score = 1161 bits (3004),  Expect = 0.0
 Identities = 610/1043 (58%), Positives = 773/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ PM AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPMVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALSHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> B1JSD3 Multidrug resistance protein MdtC [Yersinia pseudotuberculosis 
serotype O:3 (strain YPIII)]
Length=1024

 Score = 1161 bits (3004),  Expect = 0.0
 Identities = 610/1043 (58%), Positives = 773/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ PM AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPMVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALSHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> A7FG16 Multidrug resistance protein MdtC [Yersinia pseudotuberculosis 
serotype O:1b (strain IP 31758)]
Length=1024

 Score = 1160 bits (3002),  Expect = 0.0
 Identities = 610/1043 (58%), Positives = 773/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ PM AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPMVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALGHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> Q668C5 Multidrug resistance protein MdtC [Yersinia pseudotuberculosis 
serotype I (strain IP32953)]
Length=1024

 Score = 1160 bits (3002),  Expect = 0.0
 Identities = 610/1043 (58%), Positives = 773/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ PM AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPMVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALGHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> Q1C5L9 Multidrug resistance protein MdtC [Yersinia pestis bv. 
Antiqua (strain Antiqua)]
Length=1024

 Score = 1159 bits (2998),  Expect = 0.0
 Identities = 609/1043 (58%), Positives = 772/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ P  AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPKVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALSHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> Q8ZCV9 Multidrug resistance protein MdtC [Yersinia pestis]
Length=1024

 Score = 1159 bits (2998),  Expect = 0.0
 Identities = 609/1043 (58%), Positives = 772/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ P  AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPKVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALSHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> A9QZU8 Multidrug resistance protein MdtC [Yersinia pestis bv. 
Antiqua (strain Angola)]
Length=1024

 Score = 1159 bits (2998),  Expect = 0.0
 Identities = 609/1043 (58%), Positives = 772/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ P  AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPKVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALSHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> Q1CK61 Multidrug resistance protein MdtC [Yersinia pestis bv. 
Antiqua (strain Nepal516)]
Length=1024

 Score = 1159 bits (2998),  Expect = 0.0
 Identities = 609/1043 (58%), Positives = 772/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L GI+ F++LPV+ LP+VD+P I V+A   GA PE MA++VATP
Sbjct  7     FIQRPVATTLLTLAITLSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDLNRDINGAARDVQ A+NA+ + LPSG+ + 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV +GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G V+     W+V+AND+ + A  + PLIV
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA V DS+ D  NAG  A QPAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ I+++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIQLNIAQDRSPTIRASLDEVERSLVIAVALVILVVFIFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ P  AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPKVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMAGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             AW L+S              + +   I     +L+A       QQG        Y RSL 
Sbjct  487   AWLLRSH------------PKGQQQRIRGFGKVLLAI------QQG--------YGRSLN  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
              AL +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF +M  KLK
Sbjct  521   WALSHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQSMQQKLK  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DPAVD V G   GS+ N  ++F++LKPLSER +   Q++ RLR  L  E G 
Sbjct  581   DFMQIVGADPAVDSVTGFTGGSRTNSGSMFISLKPLSERQETAQQVITRLRGKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+A+YQ+TL  DDL  LR W PK++AAL+KLP L DV+SDQ  K
Sbjct  641   NLFLSSVQDIRVGGRHSNAAYQFTLLADDLAALREWEPKVRAALAKLPQLADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D + M  LGI  S+ ++ LN+AFGQRQ+STIY  +NQY VVMEVAPEY Q V
Sbjct  701   GAEMALTYDRETMARLGIDVSEANALLNNAFGQRQISTIYQPLNQYKVVMEVAPEYTQDV  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              +L  ++V N+ GQSIPLS F+ WQ AN  L+VNHQGL AASTI+FNL  G SLS+AT  
Sbjct  761   SSLDKMFVINSNGQSIPLSYFAKWQPANAPLAVNHQGLSAASTISFNLPDGGSLSEATAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             + +AM  L VPS+VRG+F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   VERAMTELGVPSTVRGAFAGTAQVFQETLKSQLWLIMAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   +   
Sbjct  881   LSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNISAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  AS+LRFRPIIMTTLAALFGALPL L  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQASLLRFRPIIMTTLAALFGALPLVLSSGDGAELRQPLGITIVGGLVVSQLLTLYT  1000

Query  1027  TPVMYLYIDQF-SRWGRRKLQHI  1048
             TPV+YLY D+  +R+ ++ L  +
Sbjct  1001  TPVIYLYFDRLRNRFSKQPLMKL  1023


> A1JKW9 Multidrug resistance protein MdtC [Yersinia enterocolitica 
serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)]
Length=1024

 Score = 1154 bits (2985),  Expect = 0.0
 Identities = 608/1044 (58%), Positives = 774/1044 (74%), Gaps = 29/1044 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI+RPVATTLL+L + L G++ F++LPV+ LP+VD+P I V+A   GA PE MA+++ATP
Sbjct  7     FIQRPVATTLLTLAITLSGVIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSIATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER LGRIAGVNE+TS SSLG+TRI LQFDL+RDINGAARDVQ A+NA+ + LPSG+ N 
Sbjct  67    LERALGRIAGVNEMTSTSSLGSTRIILQFDLSRDINGAARDVQAALNAAQSLLPSGMPNR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRK NP+DAPIMI+ LTS T S+GQ+YD A T L QK+ Q +GV DV++GGS+ PAVR
Sbjct  127   PTYRKMNPSDAPIMIMTLTSDTFSQGQLYDFASTQLAQKIAQTEGVSDVSVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             VELNPS L + G+ LDAVR AI++ N  RP+G ++   Q W+V+AND+ + A  + PLI+
Sbjct  187   VELNPSALFNQGVSLDAVRQAISAANVRRPQGSIDSSEQHWQVQANDEIKTAEGYRPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG+ +R+ DVA + DS+ D  NAG    +PAVL+++ ++P AN+I T+ RIR  LP 
Sbjct  247   HYNNGSPVRLQDVANIVDSVQDVRNAGMSDGKPAVLLVISREPGANIIATVDRIRAELPA  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+ ++P+ IE++ A DRS TI+ASL E+ER+L+IAV LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRASIPASIELNIAQDRSPTIRASLDEVERSLVIAVALVILVVFLFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ PM AA+ 
Sbjct  367   PVSLIGTFTAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGVKPMVAALR  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMSISL+AVF+P+LLM G+ GRLF EFA+TL+ AI IS+++SLT TPM+C
Sbjct  427   GVREVGFTVLSMSISLVAVFIPLLLMEGLPGRLFREFAVTLSVAIGISLVISLTLTPMMC  486

Query  487   AWWLKSRQI-KQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSL  545
             A  L+++   KQ R             I     +L+A       QQG        Y RSL
Sbjct  487   AHLLRAQPTGKQQR-------------IRGFGKVLLAI------QQG--------YGRSL  519

Query  546   AIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKL  605
                L +    +++ + TI LNV+LYI +PK FFP+QDTG MMG + ADQ+ISF AM  KL
Sbjct  520   NWVLGHTRWVMVVLLSTIALNVWLYISIPKTFFPEQDTGRMMGFIQADQSISFQAMQQKL  579

Query  606   KHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAG  665
             K  M ++  DPAVD+V G   GS+ N  ++F++LKPLSER++   Q++ RLR  L  E G
Sbjct  580   KDFMKIVSADPAVDNVTGFTGGSRTNSGSMFISLKPLSERSETAQQVITRLRGKLAKEPG  639

Query  666   TRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDV  725
                 L PVQDI VGGR S+ASYQ+TL  DDL  LR W PK++AALSKLP L DV+SDQ  
Sbjct  640   ASLFLSPVQDIRVGGRQSNASYQFTLLADDLAALREWEPKVRAALSKLPELADVNSDQQD  699

Query  726   KGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQT  785
             KG E  L +D + M  LGI  S  ++ LN+AFGQRQ+STIY  +NQY VVMEVAP+Y Q 
Sbjct  700   KGSEMALTYDRETMARLGIDVSDANALLNNAFGQRQISTIYQPLNQYKVVMEVAPQYTQD  759

Query  786   VEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATV  845
             V +L  ++V N+ GQSIPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLS+AT 
Sbjct  760   VSSLDKMFVINSNGQSIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPDGGSLSEATA  819

Query  846   QINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLT  905
              + +AM  L VPS+VRG F G+A+ FQ +L ++  LI+AAI  +YIVLGILYE + HPLT
Sbjct  820   AVERAMTELGVPSTVRGMFAGTAQVFQDTLKSQLWLIMAAIATVYIVLGILYESYVHPLT  879

Query  906   ILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPP  965
             ILSTLPSAG+GAL+AL LF+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L  
Sbjct  880   ILSTLPSAGVGALLALELFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALDAQRNGNLNA  939

Query  966   EIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLY  1025
               AI  AS+LRFRPI+MTTLAALFGALPL +  GDGAEL  PLG++IVGGL++SQ+LTLY
Sbjct  940   RDAIFQASLLRFRPILMTTLAALFGALPLVISSGDGAELRQPLGITIVGGLVMSQLLTLY  999

Query  1026  STPVMYLYIDQF-SRWGRRKLQHI  1048
             +TPV+YLY D+  SR+ ++ L  +
Sbjct  1000  TTPVVYLYFDRLRSRFSKKPLMRL  1023


> A6TBH5 Multidrug resistance protein MdtC [Klebsiella pneumoniae 
subsp. pneumoniae (strain ATCC 700721 / MGH 78578)]
Length=1025

 Score = 1150 bits (2976),  Expect = 0.0
 Identities = 606/1047 (58%), Positives = 771/1047 (74%), Gaps = 35/1047 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT L+SL + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILISLAITLCGILGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGVNE+TS+SSLG+TRI L+F+ +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L Q + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAQTIAQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V+LNP  L + G+ LDAVR+AI+  N  +P+G +E     W+V+ ND+ + AAD+ PLIV
Sbjct  187   VDLNPQALFNQGVSLDAVRTAISDANVRKPQGALEDSAHRWQVQTNDELKTAADYQPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y+NGAA+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYQNGAAVRLGDVATVSDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQQ +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LQQTIPAAIDLQIAQDRSPTIRASLEEVEQTLVISVALVILVVFLFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G++EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+ VSLT TPM+C
Sbjct  427   GSREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLAVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL----YK  542
              W LKS +  Q              P  N                  FGR+ +     Y 
Sbjct  487   GWLLKSGKPHQ--------------PTRNRG----------------FGRLLVAVQGGYG  516

Query  543   RSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMN  602
             +SL   L++  +T ++ + TI L+V+LYI +PK FFP+QDTGV+MG + ADQ+ISF AM 
Sbjct  517   KSLKWVLKHSRLTGLVVLGTIALSVWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMR  576

Query  603   TKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKY  662
              KL+  M +I +DPAVD+V G   GS++N   +F+ LKP  +R +   Q++ RLRK L  
Sbjct  577   GKLQDFMKIIREDPAVDNVTGFTGGSRVNSGMMFITLKPRDQRHETAQQVIDRLRKKLAN  636

Query  663   EAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSD  722
             E G    L  VQDI VGGR S+ASYQYTL  DDL+ LR W PKI+ AL+ LP L DV+SD
Sbjct  637   EPGANLFLMAVQDIRVGGRQSNASYQYTLLSDDLSALREWEPKIRKALAALPELADVNSD  696

Query  723   QDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEY  782
             Q   G E  L++D D M  LGI+    ++ LN+AFGQRQ+STIY  +NQY VVMEV P Y
Sbjct  697   QQDNGAEMDLVYDRDTMSRLGISVQDANNLLNNAFGQRQISTIYQPLNQYKVVMEVDPAY  756

Query  783   AQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSD  842
              Q V AL  ++V N+ G+ IPL+ F+ WQ AN  LSVNHQGL AASTI+FNL  G SLS+
Sbjct  757   TQDVSALDKMFVINSDGKPIPLAYFAKWQPANAPLSVNHQGLSAASTISFNLPTGRSLSE  816

Query  843   ATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAH  902
             A+  I++AM  L VPSSVRGSF G+A+ FQ +++A+ +LILAAI  +YIVLG+LYE + H
Sbjct  817   ASEAIDRAMTQLGVPSSVRGSFAGTAQVFQQTMNAQVILILAAIATVYIVLGVLYESYVH  876

Query  903   PLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQK  962
             PLTILSTLPSAG+GAL+AL +F+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   
Sbjct  877   PLTILSTLPSAGVGALLALEIFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRNGN  936

Query  963   LPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQIL  1022
             L PE AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+L
Sbjct  937   LTPEEAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLL  996

Query  1023  TLYSTPVMYLYIDQFS-RWGRRKLQHI  1048
             TLY+TPV+YL+ D+   R+ R   Q +
Sbjct  997   TLYTTPVVYLFFDRLRLRFSRHSSQPV  1023


> B5XPB8 Multidrug resistance protein MdtC [Klebsiella pneumoniae 
(strain 342)]
Length=1025

 Score = 1150 bits (2974),  Expect = 0.0
 Identities = 606/1047 (58%), Positives = 770/1047 (74%), Gaps = 35/1047 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT L+SL + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILISLAITLCGILGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGVNE+TS+SSLG+TRI L+F+ +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L Q + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAQTIAQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V+LNP  L + G+ LDAVR+AI+  N  +P+G +E     W+V+ ND+ + AAD+ PLIV
Sbjct  187   VDLNPQALFNQGVSLDAVRTAISDANVRKPQGALEDSAHRWQVQTNDELKTAADYQPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y+NGAA+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYQNGAAVRLGDVATVSDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQQ +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LQQTIPAAIDLQIAQDRSPTIRASLEEVEQTLVISVALVILVVFLFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE ISR +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G++EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+ VSLT TPM+C
Sbjct  427   GSREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLAVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL----YK  542
              W LKS +  Q              P  N                  FGR+ +     Y 
Sbjct  487   GWLLKSGKPHQ--------------PTRNRG----------------FGRLLVAVQGGYG  516

Query  543   RSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMN  602
             +SL   L++  +T ++ + TI L+V+LYI +PK FFP+QDTGV+MG + ADQ+ISF AM 
Sbjct  517   KSLKWVLRHSRLTGLVVLGTIALSVWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMR  576

Query  603   TKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKY  662
              KL+  M +I +DPAVD+V G   GS++N   +F+ LKP  +R +   Q++ RLRK L  
Sbjct  577   GKLQDFMKIIREDPAVDNVTGFTGGSRVNSGMMFITLKPRDQRHETAQQVIDRLRKKLAN  636

Query  663   EAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSD  722
             E G    L  VQDI VGGR S+ASYQYTL  DDL+ LR W PKI+ AL+ LP L DV+SD
Sbjct  637   EPGANLFLMAVQDIRVGGRQSNASYQYTLLSDDLSALREWEPKIRKALAALPELADVNSD  696

Query  723   QDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEY  782
             Q   G E  L++D D M  LGI+    ++ LN+AFGQRQ+STIY  +NQY VVMEV P Y
Sbjct  697   QQDNGAEMDLVYDRDTMSRLGISVQDANNLLNNAFGQRQISTIYQPLNQYKVVMEVDPAY  756

Query  783   AQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSD  842
              Q V AL  ++V N+ G+ IPL+ F+ WQ AN  LSVNHQGL AASTI+FNL  G SLS+
Sbjct  757   TQDVSALDKMFVINSEGKPIPLAYFAKWQPANAPLSVNHQGLSAASTISFNLPTGRSLSE  816

Query  843   ATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAH  902
             A+  IN+ M  L VPSSVRGSF G+A+ FQ +++A+ +LILAAI  +YIVLG+LYE + H
Sbjct  817   ASDAINRTMTQLGVPSSVRGSFAGTAQVFQQTMNAQVILILAAIATVYIVLGMLYESYVH  876

Query  903   PLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQK  962
             PLTILSTLPSAG+GAL+AL +F+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   
Sbjct  877   PLTILSTLPSAGVGALLALEIFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRTGN  936

Query  963   LPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQIL  1022
             L PE AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+L
Sbjct  937   LAPEEAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLL  996

Query  1023  TLYSTPVMYLYIDQFS-RWGRRKLQHI  1048
             TLY+TPV+YL+ D+   R+ R   Q +
Sbjct  997   TLYTTPVVYLFFDRLRLRFSRHSSQPV  1023


> A7ZNP9 Multidrug resistance protein MdtC [Escherichia coli O139:H28 
(strain E24377A / ETEC)]
Length=1025

 Score = 1146 bits (2965),  Expect = 0.0
 Identities = 600/1043 (58%), Positives = 767/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS+SSLG+TRI LQFD +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L   + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VR+AI++ N  +P+G +E     W+++ ND+ + AA++ PLI+
Sbjct  187   VGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG A+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ+ +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRAT+IPA+ V
Sbjct  307   LQETIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATIIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI+IS+LVSLT TPM+C
Sbjct  427   GTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIVISLLVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK+ + ++ +             +     +LVA       QQG        Y +SL 
Sbjct  487   GWMLKASKPREQK------------RLRGFGRMLVA------LQQG--------YGKSLK  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +  ++ + TI LN++LYI +PK FFP+QDTGV+MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHTRLVGVVLLGTIALNIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I  DPAVD+V G   GS++N   +F+ LKP  ER++   QI+ RLR  L  E G 
Sbjct  581   DFMKIIRDDPAVDNVTGFTGGSRVNSGMMFITLKPRDERSETAQQIIDRLRVKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+ASYQYTL  DDL  LR W PKI+  L+ LP L DV+SDQ   
Sbjct  641   NLFLMAVQDIRVGGRQSNASYQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQQDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L++D D M  LGI     +S LN+AFGQRQ+STIY  MNQY VVMEV P Y Q +
Sbjct  701   GAEMNLVYDRDTMARLGIDVQAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V NN G++IPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLSDA+  
Sbjct  761   SALEKMFVINNEGKAIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I++AM  L VPS+VRGSF G+A+ FQ +++++ +LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   IDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LFN  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L P+
Sbjct  881   LSTLPSAGVGALLALELFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQ  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRRKLQHI  1048
             TPV+YL+ D+   R+ R+  Q +
Sbjct  1001  TPVVYLFFDRLRLRFSRKPKQTV  1023


> Q1R9Z5 Multidrug resistance protein MdtC [Escherichia coli (strain 
UTI89 / UPEC)]
Length=1025

 Score = 1146 bits (2965),  Expect = 0.0
 Identities = 601/1043 (58%), Positives = 767/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS+SSLG+TRI LQFD +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L   + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VR+AI++ N  +P+G +E     W+++ ND+ + AA++ PLI+
Sbjct  187   VGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG A+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ  +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRAT+IPA+ V
Sbjct  307   LQSTIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATIIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+LVSLT TPM+C
Sbjct  427   GTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLLVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK+ + ++ +             +     +LVA       QQG        Y +SL 
Sbjct  487   GWMLKASKPREQK------------RLRGFGRMLVA------LQQG--------YGKSLK  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +  ++ + TI LN++LYI +PK FFP+QDTGV+MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHTRLVGVVLLGTIALNIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I  DPAVD+V G   GS++N   +F+ LKP  ER++   QI+ RLRK L  E G 
Sbjct  581   DFMKIIRDDPAVDNVTGFTGGSRVNSGMMFITLKPRGERSETAQQIIDRLRKKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR ++ASYQYTL  DDL  LR W PKI+  L+ LP L DV+SDQ+  
Sbjct  641   NLFLMAVQDIRVGGRQANASYQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQEDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  LI+D D M  LGI     +S LN+AFGQRQ+STIY  MNQY VVMEV P Y Q +
Sbjct  701   GAEMNLIYDRDTMARLGIDVQAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V NN G++IPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLSDA+  
Sbjct  761   SALEKMFVINNEGKAIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I++AM  L VPS+VRGSF G+A+ FQ +++++ +LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   IDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LFN  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L P+
Sbjct  881   LSTLPSAGVGALLALQLFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQ  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRRKLQHI  1048
             TPV+YL+ D+   R+ R+  Q +
Sbjct  1001  TPVVYLFFDRLRLRFSRKPKQAV  1023


> B7UTB4 Multidrug resistance protein MdtC [Escherichia coli O127:H6 
(strain E2348/69 / EPEC)]
Length=1025

 Score = 1146 bits (2965),  Expect = 0.0
 Identities = 601/1043 (58%), Positives = 767/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS+SSLG+TRI LQFD +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L   + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VR+AI++ N  +P+G +E     W+++ ND+ + AA++ PLI+
Sbjct  187   VGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG A+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ  +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRAT+IPA+ V
Sbjct  307   LQSTIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATIIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+LVSLT TPM+C
Sbjct  427   GTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLLVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK+ + ++ +             +     +LVA       QQG        Y +SL 
Sbjct  487   GWMLKASKPREQK------------RLRGFGRMLVA------LQQG--------YGKSLK  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +  ++ + TI LN++LYI +PK FFP+QDTGV+MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHTRLVGVVLLGTIALNIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I  DPAVD+V G   GS++N   +F+ LKP  ER++   QI+ RLRK L  E G 
Sbjct  581   DFMKIIRDDPAVDNVTGFTGGSRVNSGMMFITLKPRGERSETAQQIIDRLRKKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR ++ASYQYTL  DDL  LR W PKI+  L+ LP L DV+SDQ+  
Sbjct  641   NLFLMAVQDIRVGGRQANASYQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQEDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  LI+D D M  LGI     +S LN+AFGQRQ+STIY  MNQY VVMEV P Y Q +
Sbjct  701   GAEMNLIYDRDTMARLGIDVQAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V NN G++IPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLSDA+  
Sbjct  761   SALEKMFVINNEGKAIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I++AM  L VPS+VRGSF G+A+ FQ +++++ +LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   IDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LFN  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L P+
Sbjct  881   LSTLPSAGVGALLALELFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQ  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRRKLQHI  1048
             TPV+YL+ D+   R+ R+  Q +
Sbjct  1001  TPVVYLFFDRLRLRFSRKPKQAV  1023


> Q0TG14 Multidrug resistance protein MdtC [Escherichia coli O6:K15:H31 
(strain 536 / UPEC)]
Length=1025

 Score = 1145 bits (2962),  Expect = 0.0
 Identities = 601/1043 (58%), Positives = 766/1043 (73%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS+SSLG+TRI LQFD +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L   + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VR+AI++ N  +P+G +E     W+++ ND+ + AA++ PLI+
Sbjct  187   VGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDDTHRWQIQTNDELKTAAEYQPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG A+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ  +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRAT+IPA+ V
Sbjct  307   LQSTIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATIIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+LVSLT TPM+C
Sbjct  427   GTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLLVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK+ + ++ +             +     +LVA       QQG        Y +SL 
Sbjct  487   GWMLKASKPREQK------------RLRGFGRMLVA------LQQG--------YGKSLK  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +   + + TI LN++LYI +PK FFP+QDTGV+MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHTRLVGAVLLGTIALNIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I  DPAVD+V G   GS++N   +F+ LKP  ER++   QI+ RLRK L  E G 
Sbjct  581   DFMKIIRDDPAVDNVTGFTGGSRVNSGMMFITLKPRGERSETAQQIIDRLRKKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR ++ASYQYTL  DDL  LR W PKI+  L+ LP L DV+SDQ+  
Sbjct  641   NLFLMAVQDIRVGGRQANASYQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQEDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  LI+D D M  LGI     +S LN+AFGQRQ+STIY  MNQY VVMEV P Y Q +
Sbjct  701   GAEMNLIYDRDTMARLGIDVQAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V NN G++IPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLSDA+  
Sbjct  761   SALEKMFVINNEGKAIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I++AM  L VPS+VRGSF G+A+ FQ +++++ +LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   IDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LFN  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L P+
Sbjct  881   LSTLPSAGVGALLALELFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQ  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRRKLQHI  1048
             TPV+YL+ D+   R+ R+  Q +
Sbjct  1001  TPVVYLFFDRLRLRFSRKPKQAV  1023


> Q3Z0C8 Multidrug resistance protein MdtC [Shigella sonnei (strain 
Ss046)]
Length=1025

 Score = 1145 bits (2961),  Expect = 0.0
 Identities = 600/1043 (58%), Positives = 767/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS+SSLG+TRI LQFD +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L   + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VR+AI++ N  +P+G +E     W+++ ND+ + AA++ PLI+
Sbjct  187   VGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG A+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ+ +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRAT+IPA++V
Sbjct  307   LQETIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATIIPAVSV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+LVSLT TPM+C
Sbjct  427   GTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLLVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK+ + ++ +             +     +LVA       QQG        Y +SL 
Sbjct  487   GWMLKASKPREQK------------RLRGFGRMLVA------LQQG--------YGKSLK  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +  ++ + TI LN++LYI +PK FFP+QDTGV+MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHTRLVGVVLLGTIALNIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I  DPAVD+V G   GS++N   +F+ LKP  ER++   QI+ RLR  L  E G 
Sbjct  581   DFMKIIRDDPAVDNVTGFTGGSRVNSGMMFITLKPRDERSETAQQIIDRLRVKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+ASYQYTL  DDL  LR W PKI+  L+ LP L DV+SDQ   
Sbjct  641   NLFLMAVQDIRVGGRQSNASYQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQQDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L++D D M  LGI     +S LN+AFGQRQ+STIY  MNQY VVMEV P Y Q +
Sbjct  701   GAEMNLVYDRDTMARLGIDVQAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V NN G++IPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLSDA+  
Sbjct  761   SALEKMFVINNEGKAIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I++AM  L VPS+VRGSF G+A+ FQ +++++ +LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   IDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LFN  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L P+
Sbjct  881   LSTLPSAGVGALLALELFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQ  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRHPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRRKLQHI  1048
             TPV+YL+ D+   R+ R+  Q +
Sbjct  1001  TPVVYLFFDRLRLRFSRKPKQTV  1023


> Q8FG03 Multidrug resistance protein MdtC [Escherichia coli O6:H1 
(strain CFT073 / ATCC 700928 / UPEC)]
Length=1025

 Score = 1145 bits (2961),  Expect = 0.0
 Identities = 601/1043 (58%), Positives = 766/1043 (73%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS+SSLG+TRI LQFD +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L   + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VR+AI++ N  +P+G +E     W+++ ND+ + AA++ PLI+
Sbjct  187   VGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG A+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ  +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRAT+IPA+ V
Sbjct  307   LQSTIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATIIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+LVSLT TPM+C
Sbjct  427   GTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLLVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK+ + ++ +             +     +LVA       QQG        Y +SL 
Sbjct  487   GWMLKASKPREQK------------RLRGFGRMLVA------LQQG--------YGKSLK  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +   + + TI LN++LYI +PK FFP+QDTGV+MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHTRLVGAVLLGTIALNIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I  DPAVD+V G   GS++N   +F+ LKP  ER++   QI+ RLRK L  E G 
Sbjct  581   DFMKIIRDDPAVDNVTGFTGGSRVNSGMMFITLKPRGERSETAQQIIDRLRKKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR ++ASYQYTL  DDL  LR W PKI+  L+ LP L DV+SDQ+  
Sbjct  641   NLFLMAVQDIRVGGRQANASYQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQEDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  LI+D D M  LGI     +S LN+AFGQRQ+STIY  MNQY VVMEV P Y Q +
Sbjct  701   GAEMNLIYDRDTMARLGIDVQAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V NN G++IPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLSDA+  
Sbjct  761   SALEKMFVINNEGKAIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I++AM  L VPS+VRGSF G+A+ FQ +++++ +LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   IDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LFN  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L P+
Sbjct  881   LSTLPSAGVGALLALELFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQ  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRRKLQHI  1048
             TPV+YL+ D+   R+ R+  Q +
Sbjct  1001  TPVVYLFFDRLRLRFSRKPKQAV  1023


> P76399 Multidrug resistance protein MdtC [Escherichia coli (strain 
K12)]
Length=1025

 Score = 1144 bits (2959),  Expect = 0.0
 Identities = 599/1043 (57%), Positives = 767/1043 (74%), Gaps = 27/1043 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS+SSLG+TRI LQFD +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L   + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VR+A+++ N  +P+G +E     W+++ ND+ + AA++ PLI+
Sbjct  187   VGLNPQALFNQGVSLDDVRTAVSNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLII  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NG A+R+ DVA V DS+ D  NAG    +PA+L+M+ K P AN+I+T+  IR  LP 
Sbjct  247   HYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             LQ+ +P+ I++  A DRS TI+ASL E+E+TL+I+V LVI+VVF+FLR+GRAT+IPA++V
Sbjct  307   LQETIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATIIPAVSV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRL  EFA+TL+ AI IS+LVSLT TPM+C
Sbjct  427   GTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLLVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK+ + ++ +             +     +LVA       QQG        Y +SL 
Sbjct  487   GWMLKASKPREQK------------RLRGFGRMLVA------LQQG--------YGKSLK  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +  ++ + TI LN++LYI +PK FFP+QDTGV+MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHTRLVGVVLLGTIALNIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I  DPAVD+V G   GS++N   +F+ LKP  ER++   QI+ RLR  L  E G 
Sbjct  581   DFMKIIRDDPAVDNVTGFTGGSRVNSGMMFITLKPRDERSETAQQIIDRLRVKLAKEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+ASYQYTL  DDL  LR W PKI+  L+ LP L DV+SDQ   
Sbjct  641   NLFLMAVQDIRVGGRQSNASYQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQQDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L++D D M  LGI     +S LN+AFGQRQ+STIY  MNQY VVMEV P Y Q +
Sbjct  701   GAEMNLVYDRDTMARLGIDVQAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V NN G++IPLS F+ WQ AN  LSVNHQGL AASTI+FNL  G SLSDA+  
Sbjct  761   SALEKMFVINNEGKAIPLSYFAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I++AM  L VPS+VRGSF G+A+ FQ +++++ +LI+AAI  +YIVLGILYE + HPLTI
Sbjct  821   IDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LFN  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR   L P+
Sbjct  881   LSTLPSAGVGALLALELFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQ  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDG+EL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   EAIFQACLLRFRPIMMTTLAALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRRKLQHI  1048
             TPV+YL+ D+   R+ R+  Q +
Sbjct  1001  TPVVYLFFDRLRLRFSRKPKQTV  1023


> A7MHJ0 Multidrug resistance protein MdtC [Cronobacter sakazakii 
(strain ATCC BAA-894)]
Length=1029

 Score = 1144 bits (2958),  Expect = 0.0
 Identities = 598/1038 (58%), Positives = 762/1038 (73%), Gaps = 27/1038 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVAT LLS+ + L G+L F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIYRPVATILLSIAVTLCGVLGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGVNE+TS SSLG+TRI L+F+ +RDINGAARDVQ AINA+ + LPSG+ + 
Sbjct  67    LERSLGRIAGVNEMTSTSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMIL LTS T S+G++YD A T L Q + QIDGVGDV++GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMILTLTSDTFSQGELYDYASTQLAQTIAQIDGVGDVDVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LD VRSAI++ N  RP+G +E   + W+++ ND+ + AA++ PLIV
Sbjct  187   VALNPQALFNQGVSLDTVRSAISNANVRRPQGAIEDAQRRWQLQTNDELKTAAEYEPLIV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NGAA+ + DVA V DS+ D  NAG    +PA+L+M+ K P AN+IET+ RIR  LP 
Sbjct  247   HYNNGAAVHLRDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIETVDRIRAALPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+  +P+ I++  A DRS TI+ASL E+E++L I+V LVI+VVF+FLR+GRATLIPA+ V
Sbjct  307   LRDTIPAAIDMQIAQDRSPTIRASLAEVEQSLAISVGLVILVVFLFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IV LE ISR +E G+ P+QAA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVALENISRHLEAGVKPLQAALQ  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SL+AVF+P+LLMGG+ GRLF EFA+TL+ AI IS++VSLT TPM+C
Sbjct  427   GVREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLFREFAVTLSVAIGISLVVSLTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
              W LK++  ++ R           + +  + +LL                    Y RSL 
Sbjct  487   GWLLKAKPSEETR-----------SRVGINRLLLALQGG---------------YARSLG  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +  ++ + TI LNV+LYI +PK FFP+QDTG +MG + ADQ+ISF AM  KL+
Sbjct  521   WVLNHARLVGLVLLATIALNVWLYISIPKTFFPEQDTGRLMGGIQADQSISFQAMRGKLQ  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M +I +DPAVD+V G   GS++N   +F++LKPL ERT+   Q++ RLRK L  E G 
Sbjct  581   DFMKIIREDPAVDNVTGFTGGSRVNSGMMFISLKPLGERTESAQQVIDRLRKKLAREPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR S+ASYQYTL  DDL  LR W PKI+ AL+KLP L DV+SDQ   
Sbjct  641   SLFLMAVQDIRVGGRQSNASYQYTLLSDDLAALREWEPKIRQALAKLPQLADVNSDQQDN  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L++D + M  LGI+    +S LN+AFGQRQ+STIY  +NQY VVMEV P Y Q +
Sbjct  701   GAEMSLVYDRESMARLGISVQDANSLLNNAFGQRQISTIYQPLNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V N+ G+ IPLS F+ WQ AN  LSVNHQGL AASTI FNL  G SLS+A+  
Sbjct  761   SALDQMFVMNSEGKPIPLSWFAKWQPANAPLSVNHQGLSAASTIAFNLPTGVSLSEASDA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I + M  L VPSSVRGSF G+A+ FQ +++++ +LILAAI  +YIVLG+LYE + HPLTI
Sbjct  821   ITRTMTSLGVPSSVRGSFAGTAQVFQETMNSQVILILAAIATVYIVLGMLYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL  F+  FS+IALIGI+LLIGIVKKNAIMM+D AL  QR  +L   
Sbjct  881   LSTLPSAGVGALLALEAFDAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRSGQLSAR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL +  GDGAEL  PLG++IVGGL++SQ+LTLY+
Sbjct  941   DAIFQACLLRFRPIMMTTLAALFGALPLMIASGDGAELRQPLGITIVGGLVMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFS-RWGRR  1043
             TPV+YL+ D+   R+ RR
Sbjct  1001  TPVVYLFFDRLRLRFTRR  1018


> D4I6V4 Multidrug resistance protein MdtC [Erwinia amylovora (strain 
ATCC 49946 / CCPPB 0273 / Ea273 / 27-3)]
Length=1024

 Score = 1122 bits (2901),  Expect = 0.0
 Identities = 588/1039 (57%), Positives = 756/1039 (73%), Gaps = 26/1039 (3%)

Query  1     MSISTPFIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMA  60
             M   + FI RPVAT+LL+L LVL G+L F +LPVASLP++DFP I V+A   GASPE MA
Sbjct  1     MKFLSLFIYRPVATSLLTLALVLSGLLGFRMLPVASLPQMDFPVIVVSASLPGASPETMA  60

Query  61    ATVATPLERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLP  120
             ++VATPLER LGRIAGV+E+TS+SSLG+T + L FD +RDINGAARDVQGAINA+ + LP
Sbjct  61    SSVATPLERALGRIAGVSEMTSSSSLGSTEVVLMFDFDRDINGAARDVQGAINAAQSLLP  120

Query  121   SGLQNNPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGS  180
             SG+   P+YRK NP+DAPIMI+ L+S T S GQ+YD A T L Q+L QIDGVGDV IGGS
Sbjct  121   SGMPRRPSYRKVNPSDAPIMIMTLSSDTFSPGQLYDYASTQLAQRLSQIDGVGDVTIGGS  180

Query  181   AQPAVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAAD  240
             + PAVRV+LNP  L + G+ LDAVR+ I + N  RP+G ++ + Q W +K ND+   AA+
Sbjct  181   SLPAVRVDLNPQALFNQGVSLDAVRTTIANANVRRPQGAIDDRQQRWWLKTNDELHTAAE  240

Query  241   FIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRI  300
             + PL++ Y  GAA+R+ DVA V DS+ +  NAG    +PAVL+++ K P ANVI+TI RI
Sbjct  241   YRPLVIRYHQGAAVRLQDVATVTDSVENVRNAGMSNARPAVLVVIRKSPQANVIDTIDRI  300

Query  301   RDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATL  360
             RD +P L++ +P+ I++  A D S TI+ASL E+E++L ++V LV++VVF FLR+GRATL
Sbjct  301   RDEVPQLRKTIPAAIQLEIAQDSSATIRASLHEVEQSLAVSVGLVVLVVFAFLRSGRATL  360

Query  361   IPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSP  420
             IPA+ VP+SLIGTF  MY  GFSLNN+SLMALT+A+GFVVDD IVVLE ISR +E GL P
Sbjct  361   IPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTVASGFVVDDAIVVLENISRHVEAGLKP  420

Query  421   MQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLT  480
             +QAA+ G +EV FTVVSMS+SLIAVF+P+L+ GGI+GR F EFA+TL+ +I IS+++SLT
Sbjct  421   LQAALLGGREVGFTVVSMSVSLIAVFIPLLMQGGIIGRFFREFAITLSVSIAISLVISLT  480

Query  481   TTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLL  540
              TP++CA  L+S   +Q +P      R          MLLV        QQG        
Sbjct  481   LTPVMCARLLRSSAPRQ-QPRRRGFGR----------MLLVV-------QQG--------  514

Query  541   YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDA  600
             Y R+L   L +    L++F+ ++GL VYL+I +PK F P+QDTG +MG + ADQ+ SF A
Sbjct  515   YGRALHRVLDHARWALLVFVASLGLTVYLFISMPKTFMPEQDTGRLMGFIQADQSTSFQA  574

Query  601   MNTKLKHDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKAL  660
             M +K++H M V+  DPAV+ V+G   G + N   +F+ALKPLS R D+  Q++ARLR  L
Sbjct  575   MRSKVEHFMRVVHADPAVESVVGFTGGWETNSGAMFIALKPLSTRGDNAQQVIARLRSKL  634

Query  661   KYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVS  720
               EAG    LR VQDI +G R SD  YQY+L  D L+ LR W PKI+ A + LP L DV+
Sbjct  635   AKEAGATLWLRAVQDIRIGARQSDGGYQYSLLSDSLDDLRQWQPKIRRAFASLPELVDVN  694

Query  721   SDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAP  780
             SDQ  KG E  L +D  +M  LGI  + V+  LN+AFGQRQ+STIY  +NQY VVM V  
Sbjct  695   SDQQDKGAEMALTYDRTRMARLGIDVADVNGLLNNAFGQRQISTIYQPLNQYQVVMGVDA  754

Query  781   EYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSL  840
              YAQ + AL  +YV N+ GQ IPLS+F++WQ AN  LSV H+GL A ST++FNL  G SL
Sbjct  755   RYAQDINALNQMYVTNHQGQPIPLSSFASWQPANAPLSVEHEGLSAVSTLSFNLPEGVSL  814

Query  841   SDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDF  900
             S A   I++++  L +PSSVRGSF G+A  F+ + S++  LILAAI  +YIVLG+LYE +
Sbjct  815   SQAAAAIDRSVIALGMPSSVRGSFSGTAAVFEQTQSSQLWLILAAIATVYIVLGMLYESY  874

Query  901   AHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQ  960
              HPLTILSTLPSAG+GAL+AL LFN  FS+IALIGILLLIGIVKKNAIMM+D AL  QRQ
Sbjct  875   VHPLTILSTLPSAGMGALLALKLFNTPFSLIALIGILLLIGIVKKNAIMMVDFALQAQRQ  934

Query  961   QKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQ  1020
               +P   AI  AS+LRFRPIIMTTLAA+ GALPL L  GDGAEL  PLG++IVGGL++SQ
Sbjct  935   DGMPVREAIFQASLLRFRPIIMTTLAAMLGALPLVLSSGDGAELRQPLGITIVGGLVVSQ  994

Query  1021  ILTLYSTPVMYLYIDQFSR  1039
             +LTL++TPV+YLY+D+  R
Sbjct  995   LLTLFTTPVVYLYMDKLRR  1013


 Score = 43.1 bits (100),  Expect = 2e-06
 Identities = 64/323 (20%), Positives = 134/323 (41%), Gaps = 28/323 (9%)

Query  192   SQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPL---IVSY  248
             +++A  GI +  V   + +    R    + Q    ++V     AR A D   L    V+ 
Sbjct  711   TRMARLGIDVADVNGLLNNAFGQRQISTIYQPLNQYQVVMGVDARYAQDINALNQMYVTN  770

Query  249   KNGAAIRISDVAQVQDSILDRHNAGYYADQP---AVLMMVFKQPNANVIETIQRIRDTLP  305
               G  I +S  A  Q +     NA    +     AV  + F  P    +       D   
Sbjct  771   HQGQPIPLSSFASWQPA-----NAPLSVEHEGLSAVSTLSFNLPEGVSLSQAAAAIDR-S  824

Query  306   TLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAIT  365
              +   +PS +             A   + + + L  ++  I  V++ L     + +  +T
Sbjct  825   VIALGMPSSVR-----GSFSGTAAVFEQTQSSQLWLILAAIATVYIVLGMLYESYVHPLT  879

Query  366   VPISLIGTFGL-------MYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGL  418
             + +S + + G+       ++ + FSL  I+L+ + +  G V  + I++++   +   +  
Sbjct  880   I-LSTLPSAGMGALLALKLFNTPFSL--IALIGILLLIGIVKKNAIMMVDFALQAQRQDG  936

Query  419   SPMQAAITGAKEVSFTVVSMS-ISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLV  477
              P++ AI  A  + F  + M+ ++ +   +P++L  G    L     +T+   +++S L+
Sbjct  937   MPVREAIFQASLLRFRPIIMTTLAAMLGALPLVLSSGDGAELRQPLGITIVGGLVVSQLL  996

Query  478   SLTTTPMLCAWWLKSRQIKQMRP  500
             +L TTP++  +  K R+  + RP
Sbjct  997   TLFTTPVVYLYMDKLRRKPRWRP  1019


> F2EYE0 Multidrug resistance protein MdtC [Pantoea ananatis (strain 
AJ13355)]
Length=1025

 Score = 1121 bits (2899),  Expect = 0.0
 Identities = 594/1033 (58%), Positives = 746/1033 (72%), Gaps = 26/1033 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVATTLL+L + L GIL F +LPVA LP+VDFP I V+A   GASPE MA++VATP
Sbjct  7     FIHRPVATTLLTLAIALAGILGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATP  66

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER+LGRIAGV+E+TS SSLG+TRI + FD +RDINGAARDVQ AINA+ + LP+G+ + 
Sbjct  67    LERSLGRIAGVSEMTSTSSLGSTRIIMVFDFDRDINGAARDVQAAINAAQSLLPTGMPSR  126

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             PTYRKANP+DAPIMI+ LTS   S  Q+YD A T L QKL QI+GVGDV +GGS+ PAVR
Sbjct  127   PTYRKANPSDAPIMIMTLTSDLYSPAQLYDYASTQLAQKLSQINGVGDVTVGGSSLPAVR  186

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LNP  L + G+ LDAVR  I++ N  RP+G VE   Q W+++ ND  + A+++ PL+V
Sbjct  187   VALNPQALFNQGVSLDAVRQTISNANQRRPQGAVEDGQQRWQLRTNDALQTASEYQPLVV  246

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
              Y NGAA+R+SDVA VQDS+ D  NAG    +PAVL+++ K  +ANVIET+ RIR  LP 
Sbjct  247   HYNNGAAVRLSDVATVQDSVQDVRNAGMSRGKPAVLLVIRKTADANVIETVDRIRAELPE  306

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L + +P+ I +  A DRS TI+ASL E+E++L+IAV LVI+VVFVFLR+GRATLIPA+ V
Sbjct  307   LHEIIPAAINLEVAQDRSPTIRASLEEVEQSLMIAVALVILVVFVFLRSGRATLIPAVAV  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFSLNN+SLMALTIATGFVVDD IVVLE I+R +E G+ PM AA+ 
Sbjct  367   PVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHVEAGMKPMAAALK  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G +EV FTV+SMS+SLIAVF+P+L+ GG++GR F EF++TL+ AILIS+ VS+T TPM+C
Sbjct  427   GVREVGFTVLSMSLSLIAVFLPLLMTGGLIGRFFAEFSITLSVAILISLFVSVTLTPMMC  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             A+ LK               RS+        +LL         Q+G        Y RSL 
Sbjct  487   AYLLKPH-----------APRSQPQRRGVGRLLLAV-------QRG--------YARSLT  520

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
             + L +    L++ + T+ L V+L+I +PK F P+QDTG + G + ADQ+ISF AM  KL+
Sbjct  521   VVLNHARWVLLLLLGTVALTVWLFISIPKTFLPEQDTGRLSGFISADQSISFQAMRGKLE  580

Query  607   HDMAVIGKDPAVDHVMGTISGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKYEAGT  666
               M ++G DP V  V+G   G + N   +F++LKPLSER D    ++ARLR  L  E G 
Sbjct  581   DFMKIVGADPDVSSVVGFTGGMRTNMGLMFISLKPLSERKDTAQAVIARLRAKLANEPGA  640

Query  667   RFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSDQDVK  726
                L  VQDI VGGR ++ASYQY+L  DDL  LR+W PKI+ A + LP L DV+SDQ  K
Sbjct  641   NLYLNAVQDIRVGGREANASYQYSLLSDDLAALRTWEPKIRQAFTALPELADVNSDQQDK  700

Query  727   GLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEYAQTV  786
             G E  L +D   M  LGI  S+ ++ LNDAFGQRQ+STIY  +NQY VVMEV P Y Q +
Sbjct  701   GSEMALTYDRASMARLGINVSEANALLNDAFGQRQISTIYQPLNQYKVVMEVDPRYTQDI  760

Query  787   EALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSDATVQ  846
              AL  ++V N+ G+ IPL+ F+ WQ AN  LSVNH+GL AASTI+FNL  G SLS A+  
Sbjct  761   SALNQMFVINSEGKPIPLAWFAKWQPANAPLSVNHEGLSAASTISFNLPEGVSLSQASEA  820

Query  847   INQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAHPLTI  906
             I + M  L VPSSVRGSF G+A+AFQ S S++  L+LAAI  +YIVLGILYE + HPLTI
Sbjct  821   IERTMTALGVPSSVRGSFAGTAQAFQQSQSSQLWLMLAAIAAVYIVLGILYESYVHPLTI  880

Query  907   LSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQKLPPE  966
             LSTLPSAG+GAL+AL LF+  FS+IALIGILLLIGIVKKNAIMM+D AL  +R   L P 
Sbjct  881   LSTLPSAGVGALLALALFDTPFSLIALIGILLLIGIVKKNAIMMVDFALEAERNGNLSPR  940

Query  967   IAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQILTLYS  1026
              AI  A +LRFRPI+MTTLAALFGALPL L  GDGAEL  PLG++I GGLI+SQ+LTLY+
Sbjct  941   DAIFQACLLRFRPILMTTLAALFGALPLVLTSGDGAELRQPLGITIAGGLIMSQLLTLYT  1000

Query  1027  TPVMYLYIDQFSR  1039
             TPV+YL +D+  R
Sbjct  1001  TPVVYLMMDKLRR  1013


> D0ZEW1 Multidrug resistance protein MdtB [Edwardsiella tarda 
(strain EIB202)]
Length=1042

 Score =  873 bits (2255),  Expect = 0.0
 Identities = 469/1037 (45%), Positives = 672/1037 (65%), Gaps = 29/1037 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVATTLL + ++L G++A+  LPV++LP+VD+PTI V     GASP+V A+ +  P
Sbjct  19    FILRPVATTLLMIAILLAGLVAYRALPVSALPQVDYPTIQVVTLYPGASPDVTASAITAP  78

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER  G+++G+ +++S SS G + ITLQF L+  ++ A ++VQ AINA+   LP+ L   
Sbjct  79    LERQFGQMSGLQQMSSQSSGGASVITLQFQLSLALDVAEQEVQAAINAATNLLPNDLPYP  138

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             P Y K NPAD PI+ LA+ S  LS  Q+ D  +T + QK+ Q+ GVG V + G  +PAVR
Sbjct  139   PIYSKVNPADPPILTLAVVSDALSLPQVEDLVETRISQKIAQVGGVGLVTLAGGQRPAVR  198

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V LN +  A YG+  + +RSAI + N N PKG ++   +   + ANDQ R A ++  LIV
Sbjct  199   VRLNGAAAAAYGLSSETIRSAIANANVNSPKGSLDGPTRAITLNANDQLRSAQEYQNLIV  258

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
             +Y++GA + + D+A V+    +   A +  + PA+++ V +QP ANVI T   +   LP 
Sbjct  259   AYRSGAPVYLRDIASVEQGAENTQLAAWANNHPAIVINVQRQPGANVIATADAVLAQLPQ  318

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L+++LP+ ++I    DR++TI+AS+ ++   LL+AV LV+MV+++FLRN  ATLIP + V
Sbjct  319   LRESLPASVKISVLNDRTQTIRASVSDVRHELLLAVALVVMVIYLFLRNLPATLIPGVAV  378

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF  MY  GFS+NN++LMALTIATGFVVDD IVV+E I R +E G  P++AA+ 
Sbjct  379   PLSLIGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIENIERHLENGDPPLRAALK  438

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             GA E+ FT++S++ SLIAV +P+L MG I+GRLF EFA+TL  AILIS +VSLT TPM+C
Sbjct  439   GAGEIGFTIISLTFSLIAVLIPLLFMGDIIGRLFREFAVTLAVAILISAVVSLTLTPMMC  498

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             A  L    +++     L  ER                          F R+   Y R+L 
Sbjct  499   ARLLSQESLRRQNRFSLACERQ-------------------------FQRLIAGYGRALR  533

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
             +AL++  +TL + + T+ L V LY+++PKGFFPQQD  ++ G++ A Q+ISF AM  + +
Sbjct  534   LALRHPRITLGVAVATLMLTVLLYLIIPKGFFPQQDNSLIQGTVYAPQSISFSAMAERQR  593

Query  607   HDMAVIGKDPAVDHVMGTIS----GSQMNRANLFLALKPLSERTDHPDQIMARLRKALKY  662
                  + +DP V  V   +        +N   L + LKPL++R D  D+I+ RL+     
Sbjct  594   QLSEALLRDPDVASVSAFVGVDGVNPALNSGRLQIVLKPLADRRDRIDRIIPRLQALAAR  653

Query  663   EAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSD  722
               G    L+PVQD+ +      A Y +TLQ   L+ L++W P++QA L++ P L DV+SD
Sbjct  654   VGGISLYLQPVQDMTIDTLPGRARYPFTLQAMSLDELQTWVPRLQARLAQSPMLKDVNSD  713

Query  723   QDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEY  782
                +GL   +  + D    LGI    VD+ L +AFGQR +STIY   NQY VV+E    +
Sbjct  714   WQDQGLVAYVNVNRDSASRLGIAMQDVDNALYNAFGQRLISTIYTQSNQYRVVLEQERAH  773

Query  783   AQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSD  842
                + AL+ IY+    G +IPL++ +T +  +  L++NH   F ++T++FN+  GY+L  
Sbjct  774   QDGLTALQRIYLTAADGSAIPLASIATVEQRHGVLAINHLDQFPSATLSFNVPDGYTLEQ  833

Query  843   ATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAH  902
             A  +I+ A   + +P+ +   FQG+A AFQ++L +   LILAAI+ +YIVLGILYE F H
Sbjct  834   AIAEIDAARRAIGMPADMTLHFQGAALAFQSALDSTLWLILAAIVAMYIVLGILYESFIH  893

Query  903   PLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQK  962
             P+TILSTLPSAG+GAL+AL++      VIA+IGI+LLIGIVKKNAIMMID AL  +R Q 
Sbjct  894   PITILSTLPSAGVGALLALMISGQALDVIAIIGIILLIGIVKKNAIMMIDFALAAERTQG  953

Query  963   LPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQIL  1022
             + P  AI  A +LRFRPI+MTT+AAL GALPL   +G GAEL  PLG+ +VGGLI+SQIL
Sbjct  954   MAPHDAIYQACLLRFRPILMTTMAALLGALPLMFSQGVGAELRQPLGICMVGGLIVSQIL  1013

Query  1023  TLYSTPVMYLYIDQFSR  1039
             TL++TPV+YL  D+ +R
Sbjct  1014  TLFTTPVIYLAFDRLAR  1030


> P76398 Multidrug resistance protein MdtB [Escherichia coli (strain 
K12)]
Length=1040

 Score =  869 bits (2246),  Expect = 0.0
 Identities = 472/1042 (45%), Positives = 664/1042 (64%), Gaps = 29/1042 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVATTLL + ++L GI+ +  LPV++LP VD+PTI V     GASP+VM + V  P
Sbjct  16    FIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAP  75

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER  G+++G+ +++S SS G + ITLQF L   ++ A ++VQ AINA+   LPS L N 
Sbjct  76    LERQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNP  135

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             P Y K NPAD PIM LA+TS  +   Q+ D  +T + QK+ QI GVG V + G  +PAVR
Sbjct  136   PVYSKVNPADPPIMTLAVTSTAMPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRPAVR  195

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V+LN   +A  G+  + VR+AIT  N N  KG ++  ++   + ANDQ + A ++  LI+
Sbjct  196   VKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLII  255

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
             +Y+NGA IR+ DVA V+    +     +   + A++M V +QP AN+I T   IR  LP 
Sbjct  256   AYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQ  315

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L ++LP  +++    DR+  I+AS+ + +  L++A+ LV+M++++FLRN  AT+IP + V
Sbjct  316   LTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMIIYLFLRNIPATIIPGVAV  375

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SLIGTF +M    FS+NN++LMALTIATGFVVDD IVV+E ISR IE+G  P+ AA+ 
Sbjct  376   PLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYIEKGEKPLAAALK  435

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             GA E+ FT++S++ SLIAV +P+L MG IVGRLF EFA+TL  AILIS +VSLT TPM+C
Sbjct  436   GAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILISAVVSLTLTPMMC  495

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             A  L    +++      +  R+                      + +F R+   Y R LA
Sbjct  496   ARMLSQESLRKQN----RFSRA---------------------SEKMFDRIIAAYGRGLA  530

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +TL + + T+ L+V L++ +PKGFFP QD G++ G+L A Q+ SF  M  + +
Sbjct  531   KVLNHPWLTLSVALSTLLLSVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQR  590

Query  607   HDMAVIGKDPAVDHVMGTI----SGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKY  662
                 VI +DPAV  +   +    +   +N A L + LKPL ER D   +++ARL+ A+  
Sbjct  591   QVADVILQDPAVQSLTSFVGVDGTNPSLNSARLQINLKPLDERDDRVQKVIARLQTAVDK  650

Query  663   EAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSD  722
               G    L+P QD+ +  + S   YQ+TLQ   L+ L +W P++   L +LP L+DVSSD
Sbjct  651   VPGVDLFLQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLMEKLQQLPQLSDVSSD  710

Query  723   QDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEY  782
                KGL   +  D D    LGI+ + VD+ L +AFGQR +STIY   NQY VV+E   E 
Sbjct  711   WQDKGLVAYVNVDRDSASRLGISMADVDNALYNAFGQRLISTIYTQANQYRVVLEHNTEN  770

Query  783   AQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSD  842
                + AL  I + ++ G  +PLS+ +  +     LS+NH   F  +TI+FN+   YSL D
Sbjct  771   TPGLAALDTIRLTSSDGGVVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNVPDNYSLGD  830

Query  843   ATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAH  902
             A   I      L +P  +   FQGS  AFQ++L +   LI+AA++ +YIVLGILYE F H
Sbjct  831   AVQAIMDTEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIH  890

Query  903   PLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQK  962
             P+TILSTLP+AG+GAL+AL++   E  VIA+IGI+LLIGIVKKNAIMMID AL  +R+Q 
Sbjct  891   PITILSTLPTAGVGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQG  950

Query  963   LPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQIL  1022
             + P  AI  A +LRFRPI+MTTLAAL GALPL L  G GAEL  PLG+ +VGGLI+SQ+L
Sbjct  951   MSPREAIYQACLLRFRPILMTTLAALLGALPLMLSTGVGAELRRPLGIGMVGGLIVSQVL  1010

Query  1023  TLYSTPVMYLYIDQFSRWGRRK  1044
             TL++TPV+YL  D+ + W + +
Sbjct  1011  TLFTTPVIYLLFDRLALWTKSR  1032


> D0JNB0 Multidrug resistance protein MdtB [Yersinia pestis (strain 
D182038)]
Length=1052

 Score =  869 bits (2245),  Expect = 0.0
 Identities = 468/1045 (45%), Positives = 670/1045 (64%), Gaps = 29/1045 (3%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RPVATTL  + ++L GI+ +  LPV++LP VD+PTI V     GASP+V+ +++  P
Sbjct  16    FILRPVATTLFMIAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVVTSSITAP  75

Query  67    LERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNN  126
             LER  G+++G+ ++ S SS G + ITLQF L   ++ A ++VQ AINA+   LPS L   
Sbjct  76    LERQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPYP  135

Query  127   PTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVR  186
             P Y K NPAD PI+ LA+T+  +   Q+ D  +T + QK+ Q+ GVG V + G  +PAVR
Sbjct  136   PIYNKVNPADPPILTLAVTATAIPMTQVEDMVETRIAQKISQVTGVGLVTLSGGQRPAVR  195

Query  187   VELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIV  246
             V+LN   +A  G+  + +R+AI++ N N  KG ++   +   + ANDQ + A ++  LI+
Sbjct  196   VKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGPTRSVTLSANDQMKSAEEYRDLII  255

Query  247   SYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPT  306
             +Y+NGA IR+ DVA ++    +   A +   Q A+++ + +QP  NVI T   IR+ LP 
Sbjct  256   AYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNIQRQPGVNVIATADSIREMLPE  315

Query  307   LQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
             L ++LP  +++    DR+ TI+AS+ +++  LL+A+ LV+MV+++FLRN  AT+IP+I V
Sbjct  316   LIKSLPKSVDVKVLTDRTSTIRASVNDVQFELLLAIALVVMVIYLFLRNAAATIIPSIAV  375

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             P+SL+GTF  MY  GFS+NN++LMALTIATGFVVDD IVV+E ISR IE+G  P+ AA+ 
Sbjct  376   PLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIENISRYIEKGEKPLDAALK  435

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             GA E+ FT++S++ SLIAV +P+L M  IVGRLF EFA+TL  AILIS +VSLT TPM+C
Sbjct  436   GAGEIGFTIISLTFSLIAVLIPLLFMEDIVGRLFREFAVTLAVAILISAVVSLTLTPMMC  495

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             A  L    +++      ++ R+                      +  F  +   Y  +L 
Sbjct  496   ARMLSYESLRKQN----RLSRA---------------------SEKFFDWVIAHYAVALK  530

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNISFDAMNTKLK  606
               L +  +TL +   T+ L V LY+++PKGFFP QD G++ G+L A Q++SF  M  + +
Sbjct  531   KVLNHPWLTLSVAFSTLVLTVILYLLIPKGFFPLQDNGLIQGTLEAPQSVSFSNMAERQQ  590

Query  607   HDMAVIGKDPAVDHVMGTI----SGSQMNRANLFLALKPLSERTDHPDQIMARLRKALKY  662
                A+I KDPAV+ +   +    + + +N   L + LKPLSER D   QI+ RL++++  
Sbjct  591   QVAAIILKDPAVESLTSFVGVDGTNATLNNGRLQINLKPLSERDDRIPQIITRLQESVSG  650

Query  663   EAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDLNTLRSWTPKIQAALSKLPALTDVSSD  722
               G +  L+PVQD+ +  + S   YQ+TLQ   L  L +W PK+   L +     DV+SD
Sbjct  651   VPGIKLYLQPVQDLTIDTQLSRTQYQFTLQATSLEELSTWVPKLVNELQQKAPFQDVTSD  710

Query  723   QDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYHVVMEVAPEY  782
                +GL   +  D D    LGIT + +D+ L +AFGQR +STIY   NQY VV+E   + 
Sbjct  711   WQDQGLVAFVNVDRDSASRLGITMAAIDNALYNAFGQRLISTIYTQSNQYRVVLEHDVQA  770

Query  783   AQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAASTITFNLNPGYSLSD  842
                + A   I +    G+ +PLS+ +T +     LS+NH   F ++T++FNL  GYSL +
Sbjct  771   TPGLAAFNDIRLTGIDGKGVPLSSIATIEERFGPLSINHLNQFPSATVSFNLAQGYSLGE  830

Query  843   ATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVIYIVLGILYEDFAH  902
             A   +  A   +Q+P+ +   FQGS  AFQA+L +   LI+AAI+ +YIVLG+LYE F H
Sbjct  831   AVAAVTLAEKEIQLPADITTRFQGSTLAFQAALGSTLWLIIAAIVAMYIVLGVLYESFIH  890

Query  903   PLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIMMIDVALTLQRQQK  962
             P+TILSTLP+AG+GAL+AL+L   E  VIA+IGI+LLIGIVKKNAIMMID AL  +R Q 
Sbjct  891   PITILSTLPTAGVGALLALMLTGNELDVIAIIGIILLIGIVKKNAIMMIDFALAAERDQG  950

Query  963   LPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLGVSIVGGLIISQIL  1022
             + P  AI  A +LRFRPI+MTTLAALFGALPL L  G GAEL  PLGV +VGGLI+SQ+L
Sbjct  951   MTPYDAIYQACLLRFRPILMTTLAALFGALPLMLSTGVGAELRQPLGVCMVGGLIVSQVL  1010

Query  1023  TLYSTPVMYLYIDQFSRWGRRKLQH  1047
             TL++TPV+YL  D+ +R  R K +H
Sbjct  1011  TLFTTPVIYLLFDKLARNTRGKNRH  1035


> Q8G2M6 Efflux pump membrane transporter BepE [Brucella suis biovar 
1 (strain 1330)]
Length=1051

 Score =  443 bits (1139),  Expect = 1e-139
 Identities = 324/1055 (31%), Positives = 527/1055 (50%), Gaps = 61/1055 (6%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             F+ RPV   ++S+ LVL G++   ILPVA  P +  P + V+A   GAS E +A TVA P
Sbjct  5     FVDRPVFAAVISIVLVLAGLICIRILPVAQYPELTPPQVVVSATYPGASAETVAQTVAAP  64

Query  67    LERNLGRIAGVNEITSAS-SLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN  125
             LE+ +  +  +  + S+S   GT ++T+ F L  D + A  +V   +  + +SLP  +Q 
Sbjct  65    LEQQINGVENMLYMQSSSLGSGTMQLTVTFALGTDPDQATINVNNRVQRATSSLPQEVQR  124

Query  126   -NPTYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPA  184
                T  K       ++ +  T+    R  + + A   +   L ++ GVGDV + G+   +
Sbjct  125   LGVTVDKRFTTILGMVAMFATTDRYDRTYVGNYALLNVVDDLKRLPGVGDVQLLGNIDYS  184

Query  185   VRVELNPSQLAHYGIGLDAVRSAITSTNANRPKG-FVEQKNQL---WEVKANDQAR--QA  238
             +RV L P +LA Y +    V +AI   NA    G F +Q +     +   A  Q R   A
Sbjct  185   MRVWLRPDKLAQYNLTPSDVSAAIQEQNAQFAAGRFGDQPDPHAGPFTYTATTQGRLPDA  244

Query  239   ADFIPLIV--SYKNGAAIRISDVAQVQ---DSILDRHNAGYYADQPAVLMMVFKQPNANV  293
             A F  +I+  S +N A +R+ DVA+V+   +S L   N       PAV + ++ QP AN 
Sbjct  245   AAFENIILRSSSQNAATLRLKDVARVELGTESYLVDSNLN---GTPAVPIAIYLQPGANA  301

Query  294   IETIQRIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFL  353
             + T++ I++ +  L+ + P+ I+     D +K I+ S+ E+  T + A++LV++VVF+FL
Sbjct  302   LNTMELIQNRMNELKASFPAGIDYAIPFDTTKFIKVSIEEVVHTFIEAIILVVLVVFIFL  361

Query  354   RNGRATLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISR-  412
             +N RATLIP I VPIS+IGTF  MY  GFS+N ++L  L +A G VVDD IVVLE + R 
Sbjct  362   QNWRATLIPVIAVPISIIGTFAGMYVLGFSINLLTLFGLVLAIGIVVDDAIVVLENVERI  421

Query  413   RIEEGLSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAIL  472
                E LSP +AAI    EV+  V+++ + L AVF+P+  MGG+VG ++ +FA+T+  ++ 
Sbjct  422   MTTEKLSPRKAAIKAMGEVTGPVIAIVLVLCAVFIPVAFMGGLVGEMYKQFAVTIAISVT  481

Query  473   ISMLVSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQG  532
             +S LV+LT TP LCA  LK    + + P                          +     
Sbjct  482   LSGLVALTLTPALCALILKPGHHEPILP--------------------------FRIFNR  515

Query  533   LFGRMTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVA  592
              F R+T  Y R +   L+   + LIIF   +G   YL+  VP    P +D G + G  V 
Sbjct  516   AFERVTSGYTRGVRFFLKRATIGLIIFAGLLGSTYYLFERVPGSLLPDEDQGFLFGVAVL  575

Query  593   DQNISFDAMNTKLKHDMAVIGKDPAVDHVMGT------ISGSQMNRANLFLALKPLSERT  646
                 S +     L      I K+PAVD+V           G + +   +F+ LK   ERT
Sbjct  576   PPAASLERTTVVLDQVSENIRKNPAVDNVFAVSGFDLLSGGLKTSAGTMFIMLKDWKERT  635

Query  647   DHPDQIMARL-RKALKYEAGTR------FTLRPVQDINVGGRSSDASYQYTLQGDDLNTL  699
               PD     L R  +   AG +      F   P+  ++  G      Y     G  + +L
Sbjct  636   T-PDADARNLPRTIMGMNAGIKDGMVLAFNPPPIMGLSTTG--GFELYVQDRTGGGVESL  692

Query  700   RSWTPKIQAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQ  759
                T  I  A +K P L  V +  D    +  +  D +K K++G+  + V + +   FG 
Sbjct  693   TQATKLITEAAAKRPELQGVRTTFDPNVPQYDIQLDREKAKAMGVPINSVFTAMQATFGS  752

Query  760   RQVSTIYNAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSV  819
               V+        Y V ++   E+ +    L+ ++V+ ++G  IPL    T +       +
Sbjct  753   LYVNDFTLYGRNYQVNLQSEAEFRRDPGDLKHVFVRADSGSMIPLDALVTVKRIVGPDQL  812

Query  820   NHQGLFAASTITFNLNPGYSLSDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEP  879
                  F A+ +T N  PGY+  DA ++  Q +    +P   + ++ GSA    ++     
Sbjct  813   ERFNAFNAAKVTGNPAPGYTSGDA-IKAMQEVAAQVLPQGYQIAWTGSAYQEVSTSGTGS  871

Query  880   LLILAAIIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLL  939
               ++  +I+++++L   YE ++ PL +++ +P A  GAL+A  L  +   V   IG++ L
Sbjct  872   QAMIFGLIMVFLILAAQYERWSLPLAVITAVPFAIFGALLATDLRGLTNDVYFQIGLVTL  931

Query  940   IGIVKKNAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRG  999
             IG+  KNAI++++ A+ L+R+       A   A+ LRFRPI+MT+LA + G +PLA+  G
Sbjct  932   IGLAAKNAILIVEFAV-LERESGKSAIEAAASAARLRFRPIVMTSLAFILGVVPLAVSTG  990

Query  1000  DGAELHIPLGVSIVGGLIISQILTLYSTPVMYLYI  1034
              G+     +G  ++GG++ +  +  +  P+ Y  I
Sbjct  991   AGSASRHSIGTGVIGGMLAATFIATFFIPMFYSLI  1025


> P25197 Nodulation protein NolG [Rhizobium meliloti (strain 1021)]
Length=1065

 Score =  438 bits (1126),  Expect = 1e-137
 Identities = 297/1054 (28%), Positives = 526/1054 (50%), Gaps = 52/1054 (5%)

Query  8     IRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATPL  67
             I  PV  T++ + +++LG+ ++  L V   P  D P + V     GASPE + + ++ P+
Sbjct  8     INHPVFATMMMVMILVLGLFSYGRLGVDHYPETDLPVVVVATTYTGASPESVESEISRPI  67

Query  68    ERNLGRIAGVNEITSASSLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQNNP  127
             E  L  I G++ ITS S  G + + +QF+++ D   AA++V+  +       P G+   P
Sbjct  68    EAALNTIGGIDTITSESYEGRSIVVVQFEVDVDSQDAAQEVRDRVARLETKFPDGVAT-P  126

Query  128   TYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPAVRV  187
                +  P    I+ +A++S + +  +I   A  ++  +L  I GVG V++ GS++  V V
Sbjct  127   QVTRYKPEGQAILSVAVSSTSRTLPEITTLATRVINNRLSVISGVGQVSLIGSSERQVLV  186

Query  188   ELNPSQLAHYGIGLDAVRSAITSTNANRPKGFVEQKNQLWEVKANDQARQAADFIPLIVS  247
              ++P +L  YG+ +  V  AI   N +R  G +        V    +    + F  +IV+
Sbjct  187   VVDPDRLGAYGLAVSTVIEAIRGENQDRAAGTLISGINQRIVTVEGRIANTSGFNRIIVA  246

Query  248   YKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETIQRIRDTLPTL  307
              +NG  + +S+VA + D+  +  +   Y  Q  + + + K   AN +E    +R  +  L
Sbjct  247   QRNGYPVYLSEVATILDTGAEVTSLANYQGQTTLGLHIVKVQGANTVEVASAVRREVSAL  306

Query  308   QQALPSQ-IEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGRATLIPAITV  366
                L    +++    D S+ I + + +++RTL+   +L +++VF+FL + R+T+I  +T+
Sbjct  307   NAELTKDNVQLTITRDNSRPIASQVSQVQRTLVEGGVLSVLIVFIFLNSWRSTVITGLTL  366

Query  367   PISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRIEEGLSPMQAAIT  426
             PIS+IGTF  +YA GF+LN ++LMAL+++ G ++DD IVV E I+R ++ G  P++AA+ 
Sbjct  367   PISVIGTFAAIYALGFTLNIMTLMALSLSIGILIDDAIVVRENITRHLQMGKDPVRAALD  426

Query  427   GAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISMLVSLTTTPMLC  486
             G  E+   V+S ++ ++AVF+P+  MGG++GR F +F +T+  A++IS+ VS T  PML 
Sbjct  427   GTNEIGLAVLSTTLCIVAVFLPVAFMGGLIGRFFLQFGVTVAVAVVISLFVSFTLDPMLS  486

Query  487   AWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGRMTLLYKRSLA  546
             + W                 +S+ T        L+   D++   +GL  R    Y+  + 
Sbjct  487   SVWCD--------------PQSQKTAKRGFFGQLIERFDQWF--EGLASR----YRSVIY  526

Query  547   IALQYKAMTLIIFIFTIGLNVYLYIVVPK---GFFPQQDTGVMMGSLVADQNISFDAMNT  603
                 Y+  T+ I    +G+ V   ++VP+    F P  D G +  SL A++  S D M  
Sbjct  527   FTFDYRKTTIAI---VLGMFVVSLLLVPRIGTEFLPPPDQGEVSISLEANEGASLDYMAA  583

Query  604   KLKHDMAVIGKDPAVDHVMGTISGSQM---NRANLFLALKPLSERTDHPDQIMARLRKAL  660
             K+      + +   V     TI+  +M   N+A + + L   S+R     + +  +R+ L
Sbjct  584   KVGQIERALREFNYVSSTYSTINSGEMRGFNKALVAVQLVHSSQRRLKTAETLGPIRRRL  643

Query  661   KYEAGTRFTLRPVQDINVGGRS----SDASYQYTLQGDDLNTLRSWTPKIQAALSKLPAL  716
                AG         +I+VG RS    S    Q ++ GD    LR  +  I + L+ +P  
Sbjct  644   SRIAGL--------EISVGQRSEVVGSIKPLQLSILGDGDEELRRISDHITSVLAAIPGA  695

Query  717   TDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQVSTIYNAMNQYH-VV  775
             T++ S  +       +    +    LG++ + +  TL        +S   +   + H VV
Sbjct  696   TEIESSIEKLRPTLAVRVRREAASDLGVSIATIGDTLRSLVAGDAISVWNSPDGETHDVV  755

Query  776   MEVAPEYAQTVEALRGIYV------QNNAGQSIPLSTFSTWQAANTSLSVNHQGLFAAST  829
             + +     +    LR + +       N     + L   +    +     +  + L     
Sbjct  756   VRLPAAGRENAAQLRNLPIATARMDDNGKPIMVLLDQVADVVESTAPAQITRKDLSRDIR  815

Query  830   ITFNLNPGYSLSDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAEPLLILAAIIVI  889
             I+ N+  G +L D    +  AM  + +P   R SF G A+    S +     +  A+I I
Sbjct  816   ISSNIE-GRTLGDVVADLKAAMTKMDIPVGFRISFGGDAENLTESTAYALQSLAMAVIFI  874

Query  890   YIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLLIGIVKKNAIM  949
             YI+L   +  F  P+ I+ T+P + +G L+ L+      ++ ++IGI++L+G+V KNAI+
Sbjct  875   YIILASQFGSFIQPIAIIMTMPLSLMGVLLGLLFTGSTLNMFSMIGIMMLMGLVTKNAIL  934

Query  950   MIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRGDGAELHIPLG  1009
             ++D +    R+ K   + ++ DA  +R RPI+MTTLA +FG LP ALG G+G     P+ 
Sbjct  935   LVDYSNLGVREGKSLRQ-SLADAGAVRLRPIVMTTLAMIFGMLPTALGLGEGGAQRAPMA  993

Query  1010  VSIVGGLIISQILTLYSTPVMYLYIDQFSRWGRR  1043
              +I+GGLI S +L+L   PV+  Y+D F+   RR
Sbjct  994   HAIIGGLISSTLLSLVFVPVVLTYLDAFAGRVRR  1027


> P24177 Probable aminoglycoside efflux pump [Escherichia coli 
(strain K12)]
Length=1037

 Score =  386 bits (992),  Expect = 9e-119
 Identities = 290/1055 (27%), Positives = 517/1055 (49%), Gaps = 60/1055 (6%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RP+   +L++ L L G LA   LPV   P +  P + VTA   GAS + +  TV   
Sbjct  5     FIDRPIFAWVLAILLCLTGTLAIFSLPVEQYPDLAPPNVRVTANYPGASAQTLENTVTQV  64

Query  67    LERNLGRIAGVNEITSASS-LGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN  125
             +E+N+  +  +  ++S SS  G   +TL F    D + A + VQ  + +++  LP  +QN
Sbjct  65    IEQNMTGLDNLMYMSSQSSGTGQASVTLSFKAGTDPDEAVQQVQNQLQSAMRKLPQAVQN  124

Query  126   NP-TYRKANPADAPIMILALTSKTLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQPA  184
                T RK    +   +    T  ++ +  I D   + +   L +++GVGD++  GS Q +
Sbjct  125   QGVTVRKTGDTNILTIAFVSTDGSMDKQDIADYVASNIQDPLSRVNGVGDIDAYGS-QYS  183

Query  185   VRVELNPSQLAHYGIGLDAVRSAITSTNANRPKG------FVEQKNQLWEVKANDQARQA  238
             +R+ L+P++L  + +    V  AI S NA    G       V+++     + A    +  
Sbjct  184   MRIWLDPAKLNSFQMTAKDVTDAIESQNAQIAVGQLGGTPSVDKQALNATINAQSLLQTP  243

Query  239   ADFIPLIVSY-KNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIETI  297
               F  + +   ++G+ +R+ DVA V+           +  +PA  + V     AN + T 
Sbjct  244   EQFRDITLRVNQDGSEVRLGDVATVEMGAEKYDYLSRFNGKPASGLGVKLASGANEMATA  303

Query  298   QRIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRNGR  357
             + + + L  L Q  P  +E   A + +  ++AS+ ++ +TLL A+ LV +V+++FL+N R
Sbjct  304   ELVLNRLDELAQYFPHGLEYKVAYETTSFVKASIEDVVKTLLEAIALVFLVMYLFLQNFR  363

Query  358   ATLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISRRI-EE  416
             ATLIP I VP+ L+GTF ++YA G+S+N +++ A+ +A G +VDD IVV+E + R + EE
Sbjct  364   ATLIPTIAVPVVLMGTFSVLYAFGYSVNTLTMFAMVLAIGLLVDDAIVVVENVERIMSEE  423

Query  417   GLSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILISML  476
             GL+P +A      ++   +V +++ L AVFVP+   GG  G ++ +F++T+  A+++S+L
Sbjct  424   GLTPREATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGTTGAIYRQFSITIVAAMVLSVL  483

Query  477   VSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLFGR  536
             V++  TP LCA  LK                    P+   E         +  Q  +F R
Sbjct  484   VAMILTPALCATLLK--------------------PLKKGEHHGQKGFFAWFNQ--MFNR  521

Query  537   MTLLYKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMMGSLVADQNI  596
                 Y++ +A  L      ++I++  +G  V+L++ +P  F P +D G+   S+      
Sbjct  522   NAERYEKGVAKILHRSLRWIVIYVLLLGGMVFLFLRLPTSFLPLEDRGMFTTSVQLPSG-  580

Query  597   SFDAMNTKLKHDMAVIGKDPAVDHVMGTIS-------GSQMNRANLFLALKPLSERTDHP  649
             S      K+   +         D++M   +       G+  N A +F+ LK  SER    
Sbjct  581   STQQQTLKVVEQIEKYYFTHEKDNIMSVFATVGSGPGGNGQNVARMFIRLKDWSERDSKT  640

Query  650   DQIMARLRKALKY-----EAGTRFTLRPVQDINVGGRSSDASYQYTLQ---GDDLNTLRS  701
                 A + +A K      EA    +  P     + G  S A +   LQ   G   + L +
Sbjct  641   GTSFAIIERATKAFNQIKEARVIASSPPA----ISGLGSSAGFDMELQDHAGAGHDALMA  696

Query  702   WTPKIQAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDAFGQRQ  761
                ++ A  ++ P LT V  +      + ++  D  K ++LG+    ++ TL  A+G   
Sbjct  697   ARNQLLALAAENPELTRVRHNGLDDSPQLQIDIDQRKAQALGVAIDDINDTLQTAWGSSY  756

Query  762   VSTIYNAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTSLSVNH  821
             V+   +      V ++ A  Y    + +   YV+N  G  +P S F+T +    S  +  
Sbjct  757   VNDFMDRGRVKKVYVQAAAPYRMLPDDINLWYVRNKDGGMVPFSAFATSRWETGSPRLER  816

Query  822   QGLFAASTITFNLNPGYSLSDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLSAE--P  879
                ++A  I     PG S   A + I +++ + Q+P+      + +A ++Q  LS    P
Sbjct  817   YNGYSAVEIVGEAAPGVSTGTA-MDIMESL-VKQLPNGF--GLEWTAMSYQERLSGAQAP  872

Query  880   LLILAAIIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGILLL  939
              L   +++V+++ L  LYE ++ P +++  +P   +GAL+A  +  +E  V   +G+L +
Sbjct  873   ALYAISLLVVFLCLAALYESWSVPFSVMLVVPLGVIGALLATWMRGLENDVYFQVGLLTV  932

Query  940   IGIVKKNAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLALGRG  999
             IG+  KNAI++++ A  + ++     E A L A   R RPI+MT+LA +FG LP+A   G
Sbjct  933   IGLSAKNAILIVEFANEMNQKGHDLFE-ATLHACRQRLRPILMTSLAFIFGVLPMATSTG  991

Query  1000  DGAELHIPLGVSIVGGLIISQILTLYSTPVMYLYI  1034
              G+     +G  ++GG+I + IL +Y  P+ ++ +
Sbjct  992   AGSGGQHAVGTGVMGGMISATILAIYFVPLFFVLV  1026


> P52002 Multidrug resistance protein MexB [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 
/ LMG 12228 / 1C / PRS 101 / PAO1)]
Length=1046

 Score =  384 bits (986),  Expect = 7e-118
 Identities = 290/1058 (27%), Positives = 513/1058 (48%), Gaps = 65/1058 (6%)

Query  7     FIRRPVATTLLSLGLVLLGILAFNILPVASLPRVDFPTISVTAKQAGASPEVMAATVATP  66
             FI RP+   +++L ++L G L+   LPV   P +  P I+V     GAS E +  TV   
Sbjct  5     FIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAVQVSYPGASAETVQDTVVQV  64

Query  67    LERNLGRIAGVNEITSAS-SLGTTRITLQFDLNRDINGAARDVQGAINASLASLPSGLQN  125
             +E+ +  I  +  I+S S S G+  IT+ F+   D + A   VQ  +  +   LP  +Q 
Sbjct  65    IEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQR  124

Query  126   NPTYRKANPADAPIMILALTSK--TLSRGQIYDAADTILGQKLLQIDGVGDVNIGGSAQP  183
                 R        +M++ + S   ++++  + +   + +   L +  GVGD  + GS Q 
Sbjct  125   QGI-RVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS-QY  182

Query  184   AVRVELNPSQLAHYGIGLDAVRSAITSTNANRPKGFV--------EQKNQLWEVKANDQA  235
             ++R+ L+P++L  Y +    V SAI + N     G +        +Q N     K   Q 
Sbjct  183   SMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGLPAVKGQQLNATIIGKTRLQT  242

Query  236   RQAADFIPLIVSYKNGAAIRISDVAQVQDSILDRHNAGYYADQPAVLMMVFKQPNANVIE  295
              +  + I L V+  +G+ +R+ DVA V     D      +   PA  + +     AN ++
Sbjct  243   AEQFENILLKVN-PDGSQVRLKDVADVGLGGQDYSINAQFNGSPASGIAIKLATGANALD  301

Query  296   TIQRIRDTLPTLQQALPSQIEIHTAVDRSKTIQASLREIERTLLIAVMLVIMVVFVFLRN  355
             T + IR T+  L+  +P  +++    D +  + AS+ E+ +TL  A++LV +V+++FL+N
Sbjct  302   TAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLVFLVMYLFLQN  361

Query  356   GRATLIPAITVPISLIGTFGLMYASGFSLNNISLMALTIATGFVVDDTIVVLETISR-RI  414
              RATLIP I VP+ L+GTFG++ A GFS+N +++  + +A G +VDD IVV+E + R   
Sbjct  362   FRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA  421

Query  415   EEGLSPMQAAITGAKEVSFTVVSMSISLIAVFVPILLMGGIVGRLFHEFAMTLTYAILIS  474
             EEGLSP +AA     ++   +V +++ L AVF+P+   GG  G ++ +F++T+  A+ +S
Sbjct  422   EEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMALS  481

Query  475   MLVSLTTTPMLCAWWLKSRQIKQMRPELLKIERSETTPISNSEMLLVASDDEYLKQQGLF  534
             ++V+L  TP LCA  LK             IE+ +                      G F
Sbjct  482   VIVALILTPALCATMLK------------PIEKGDHGEHKGGFF-------------GWF  516

Query  535   GRMTLL----YKRSLAIALQYKAMTLIIFIFTIGLNVYLYIVVPKGFFPQQDTGVMM---  587
              RM L     Y+R +A  L+++A  L+I++  +   ++++  +P  F P +D GV+    
Sbjct  517   NRMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQV  576

Query  588   ----GSLVADQNISFDAMNTKL--KHDMAVIGKDPAVDHVMG-TISGSQMNRANLFLALK  640
                 GS      +  D+M   L  K   +V     +V  V G   +G   +    F+ LK
Sbjct  577   QTPPGSSAERTQVVVDSMREYLLEKESSSV----SSVFTVTGFNFAGRGQSSGMAFIMLK  632

Query  641   PLSERTDHPDQIMARLRKA----LKYEAGTRFTLRPVQDINVGGRSSDASYQYTLQGDDL  696
             P  ER    + +    ++A      ++    F   P   + +G  +    +     G   
Sbjct  633   PWEERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPSVLELGNATGFDLFLQDQAGVGH  692

Query  697   NTLRSWTPKIQAALSKLPALTDVSSDQDVKGLETKLIFDHDKMKSLGITQSQVDSTLNDA  756
               L     K     ++ PAL  V  +      + KL  D +K  +LG++ + ++ST++ A
Sbjct  693   EVLLQARNKFLMLAAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIA  752

Query  757   FGQRQVSTIYNAMNQYHVVMEVAPEYAQTVEALRGIYVQNNAGQSIPLSTFSTWQAANTS  816
             +G   V+   +      V ++  P+     + L   YV+N+ G+ +P + F+T +    S
Sbjct  753   WGSSYVNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGS  812

Query  817   LSVNHQGLFAASTITFNLNPGYSLSDATVQINQAMNLLQVPSSVRGSFQGSAKAFQASLS  876
               +       A  I     PG S  DA   + + +   Q+P  V  S+ G +   + S S
Sbjct  813   PKLERYNGVPAMEILGEPAPGLSSGDAMAAVEEIVK--QLPKGVGYSWTGLSYEERLSGS  870

Query  877   AEPLLILAAIIVIYIVLGILYEDFAHPLTILSTLPSAGLGALIALVLFNMEFSVIALIGI  936
               P L   +++V+++ L  LYE ++ P +++  +P   +GAL+A  +  +   V   +G+
Sbjct  871   QAPALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLATSMRGLSNDVFFQVGL  930

Query  937   LLLIGIVKKNAIMMIDVALTLQRQQKLPPEIAILDASVLRFRPIIMTTLAALFGALPLAL  996
             L  IG+  KNAI++++ A  L  Q K   E AI +A  +R RPI+MT+LA + G +PLA+
Sbjct  931   LTTIGLSAKNAILIVEFAKELHEQGKGIVEAAI-EACRMRLRPIVMTSLAFILGVVPLAI  989

Query  997   GRGDGAELHIPLGVSIVGGLIISQILTLYSTPVMYLYI  1034
               G G+     +G  ++GG++ + +L ++  P+ Y+ +
Sbjct  990   STGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAV  1027



Lambda      K        H        a         alpha
   0.322    0.136    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 26705468


  Database: 581623e8e51508e72263c97c269ab497.SwissProt.fasta
    Posted date:  Sep 19, 2020  3:17 PM
  Number of letters in database: 28,852
  Number of sequences in database:  28



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40