ACIAD3429 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 263107dd05fe432f085afc363c3af7cd.TrEMBL.fasta
           8 sequences; 2,950 total letters



Query= ACIAD3429

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F780 Peptidase_M78 domain-containing protein [Acinetobacter b...   728    0.0   
  A0A1E3GIV4 Peptidase [Acinetobacter sp. 51m]                         691    0.0   
  L9M3K5 PF06114 domain protein [Acinetobacter sp. OIFC021]            690    0.0   
  A0A151Y512 Peptidase [Acinetobacter pragensis]                       689    0.0   
  N8UMT8 Peptidase_M78 domain-containing protein [Acinetobacter s...   689    0.0   
  N8VEP4 Peptidase_M78 domain-containing protein [Acinetobacter s...   689    0.0   
  A0A0M3A1Y9 Peptidase [Acinetobacter sp. Ag2]                         688    0.0   
  A0A0F4LG35 Peptidase_M78 domain-containing protein [Lactobacill...   404    1e-142


> Q6F780 Peptidase_M78 domain-containing protein [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=370

 Score =  728 bits (1879),  Expect = 0.0
 Identities = 370/370 (100%), Positives = 370/370 (100%), Gaps = 0/370 (0%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60
            MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL
Sbjct  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120
            LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI
Sbjct  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120

Query  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180
            DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK
Sbjct  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180

Query  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240
            EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA
Sbjct  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240

Query  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300
            FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL
Sbjct  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360
            EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY
Sbjct  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360

Query  361  KILMNRGGND  370
            KILMNRGGND
Sbjct  361  KILMNRGGND  370


> A0A1E3GIV4 Peptidase [Acinetobacter sp. 51m]
Length=368

 Score =  691 bits (1784),  Expect = 0.0
 Identities = 351/370 (95%), Positives = 360/370 (97%), Gaps = 2/370 (1%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60
            MSMRIDTNTLNYYV NAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL
Sbjct  1    MSMRIDTNTLNYYVQNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120
            LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITE LDFVGQFSI
Sbjct  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITETLDFVGQFSI  120

Query  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180
            DSNFLEVAK+IRNKLEIPLFF +QADNPLNYLRDKIN IGVFVFFNGKVKDNTHRPLSVK
Sbjct  121  DSNFLEVAKQIRNKLEIPLFFHNQADNPLNYLRDKINGIGVFVFFNGKVKDNTHRPLSVK  180

Query  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240
            EFRGFVLLDHKAPIIFINQKDTK GQLFTLVHELVHIFVGTEEIFNIVD GDYQFDRTEA
Sbjct  181  EFRGFVLLDHKAPIIFINQKDTKNGQLFTLVHELVHIFVGTEEIFNIVDAGDYQFDRTEA  240

Query  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300
            FINKVTAEIL P+EI L+LNSTDSNFLARKFKVSEFVIVRRLL+LNKITREEYLNRTRDL
Sbjct  241  FINKVTAEILVPQEIFLQLNSTDSNFLARKFKVSEFVIVRRLLDLNKITREEYLNRTRDL  300

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360
            +ENLERFLP  +ESNGGSYTNNIRFRVDN+FFKYVMNAVNHDRISYTDAFNIVG+GFKGY
Sbjct  301  KENLERFLP--NESNGGSYTNNIRFRVDNRFFKYVMNAVNHDRISYTDAFNIVGIGFKGY  358

Query  361  KILMNRGGND  370
            KILMNRGGND
Sbjct  359  KILMNRGGND  368


> L9M3K5 PF06114 domain protein [Acinetobacter sp. OIFC021]
Length=368

 Score =  690 bits (1781),  Expect = 0.0
 Identities = 351/370 (95%), Positives = 360/370 (97%), Gaps = 2/370 (1%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60
            MSMRIDTNTLNYYV NAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL
Sbjct  1    MSMRIDTNTLNYYVQNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120
            LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITE LDFVGQFSI
Sbjct  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITETLDFVGQFSI  120

Query  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180
            DSNFLEVAK+IRNKLEIPLFF +QADNPLNYLRDKIN IGVFVFFNGKVKDNTHRPLSVK
Sbjct  121  DSNFLEVAKQIRNKLEIPLFFHNQADNPLNYLRDKINGIGVFVFFNGKVKDNTHRPLSVK  180

Query  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240
            EFRGFVLLDHKAPIIFINQKDTK GQLFTLVHELVHIFVGTEEIFNIV+ GDYQFDRTEA
Sbjct  181  EFRGFVLLDHKAPIIFINQKDTKNGQLFTLVHELVHIFVGTEEIFNIVEAGDYQFDRTEA  240

Query  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300
            FINKVTAEIL P+EI L+LNSTDSNFLARKFKVSEFVIVRRLL+LNKITREEYLNRTRDL
Sbjct  241  FINKVTAEILVPQEIFLQLNSTDSNFLARKFKVSEFVIVRRLLDLNKITREEYLNRTRDL  300

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360
            +ENLERFLP  +ESNGGSYTNNIRFRVDN+FFKYVMNAVNHDRISYTDAFNIVGVGFKGY
Sbjct  301  KENLERFLP--NESNGGSYTNNIRFRVDNRFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  358

Query  361  KILMNRGGND  370
            KILMNRGGND
Sbjct  359  KILMNRGGND  368


> A0A151Y512 Peptidase [Acinetobacter pragensis]
Length=368

 Score =  689 bits (1779),  Expect = 0.0
 Identities = 349/370 (94%), Positives = 362/370 (98%), Gaps = 2/370 (1%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60
            MSMRIDTNTLNYYV NAQISLSVLRTKINNLD+ LSGEKQPTFNQLSEIAKKINVPTGLL
Sbjct  1    MSMRIDTNTLNYYVQNAQISLSVLRTKINNLDEILSGEKQPTFNQLSEIAKKINVPTGLL  60

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120
            LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEIT+NLDFVGQFSI
Sbjct  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITDNLDFVGQFSI  120

Query  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180
            DSNFLEVA+KIRNKLEIPLFFQ+QADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK
Sbjct  121  DSNFLEVAQKIRNKLEIPLFFQNQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180

Query  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240
            EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTG+YQFDRTEA
Sbjct  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGNYQFDRTEA  240

Query  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300
            FINKVTAEIL P+++ L+ NSTDSNFLARKFKVSEFVIVRRLL+LNKITREEYLNRT DL
Sbjct  241  FINKVTAEILVPQKVFLEFNSTDSNFLARKFKVSEFVIVRRLLDLNKITREEYLNRTIDL  300

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360
            +ENLERFLP  SESNGGSYTNNIRFRVDN+FF+YVMNAVNHDRISYTDAFNIVGVGFKGY
Sbjct  301  KENLERFLP--SESNGGSYTNNIRFRVDNRFFRYVMNAVNHDRISYTDAFNIVGVGFKGY  358

Query  361  KILMNRGGND  370
            KILMNRGGND
Sbjct  359  KILMNRGGND  368


> N8UMT8 Peptidase_M78 domain-containing protein [Acinetobacter 
sp. CIP 102529]
Length=368

 Score =  689 bits (1779),  Expect = 0.0
 Identities = 352/370 (95%), Positives = 359/370 (97%), Gaps = 2/370 (1%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60
            MSMRIDTNTLNYYV NAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL
Sbjct  1    MSMRIDTNTLNYYVQNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120
            LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI
Sbjct  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120

Query  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180
            DSN LEVAKKIRNKLEIPLFFQ+QADN LNYLRDKIN IGVFVFFNGKVKDNTHRPLSVK
Sbjct  121  DSNVLEVAKKIRNKLEIPLFFQNQADNSLNYLRDKINGIGVFVFFNGKVKDNTHRPLSVK  180

Query  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240
            EFRGFVLLDHKAPIIFINQKDTK GQLFTLVHELVHIFVGTEEIFNIVD GDYQFDRTEA
Sbjct  181  EFRGFVLLDHKAPIIFINQKDTKNGQLFTLVHELVHIFVGTEEIFNIVDAGDYQFDRTEA  240

Query  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300
            FINKVTAEIL P+EI L+LNSTDSNFLARKFKVSEFVIVRRLL+LNKITREEYLNRTRDL
Sbjct  241  FINKVTAEILVPQEIFLQLNSTDSNFLARKFKVSEFVIVRRLLDLNKITREEYLNRTRDL  300

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360
            +ENLERFLP  +ESNGGSY NNIRFRVDN+FFKYVMNAVNHDRISYTDAFNIVGVGFKGY
Sbjct  301  KENLERFLP--NESNGGSYINNIRFRVDNRFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  358

Query  361  KILMNRGGND  370
            KILMNRGGND
Sbjct  359  KILMNRGGND  368


> N8VEP4 Peptidase_M78 domain-containing protein [Acinetobacter 
sp. CIP 102159]
Length=368

 Score =  689 bits (1779),  Expect = 0.0
 Identities = 352/370 (95%), Positives = 359/370 (97%), Gaps = 2/370 (1%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60
            MSMRIDTNTLNYYV NAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL
Sbjct  1    MSMRIDTNTLNYYVQNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120
            LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI
Sbjct  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120

Query  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180
            DSN LEVAKKIRNKLEIPLFFQ+QADN LNYLRDKIN IGVFVFFNGKVKDNTHRPLSVK
Sbjct  121  DSNVLEVAKKIRNKLEIPLFFQNQADNSLNYLRDKINGIGVFVFFNGKVKDNTHRPLSVK  180

Query  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240
            EFRGFVLLDHKAPIIFINQKDTK GQLFTLVHELVHIFVGTEEIFNIVD GDYQFDRTEA
Sbjct  181  EFRGFVLLDHKAPIIFINQKDTKNGQLFTLVHELVHIFVGTEEIFNIVDAGDYQFDRTEA  240

Query  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300
            FINKVTAEIL P+EI L+LNSTDSNFLARKFKVSEFVIVRRLL+LNKITREEYLNRTRDL
Sbjct  241  FINKVTAEILVPQEIFLQLNSTDSNFLARKFKVSEFVIVRRLLDLNKITREEYLNRTRDL  300

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360
            +ENLERFLP  +ESNGGSY NNIRFRVDN+FFKYVMNAVNHDRISYTDAFNIVGVGFKGY
Sbjct  301  KENLERFLP--NESNGGSYINNIRFRVDNRFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  358

Query  361  KILMNRGGND  370
            KILMNRGGND
Sbjct  359  KILMNRGGND  368


> A0A0M3A1Y9 Peptidase [Acinetobacter sp. Ag2]
Length=368

 Score =  688 bits (1775),  Expect = 0.0
 Identities = 349/370 (94%), Positives = 360/370 (97%), Gaps = 2/370 (1%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60
            MSMRIDTNTLNYYV NAQISLSVLR KINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL
Sbjct  1    MSMRIDTNTLNYYVQNAQISLSVLRAKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLL  60

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQFSI  120
            LL+KTIDIDIKRLDFRTLESDSIDEASEELRDTI EMEVKQEFLKNEI ENLDFVGQFSI
Sbjct  61   LLDKTIDIDIKRLDFRTLESDSIDEASEELRDTILEMEVKQEFLKNEILENLDFVGQFSI  120

Query  121  DSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180
            DSNF EVA+KIRNKLEIPLFFQ+QADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK
Sbjct  121  DSNFQEVARKIRNKLEIPLFFQNQADNPLNYLRDKINDIGVFVFFNGKVKDNTHRPLSVK  180

Query  181  EFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEA  240
            EFRGFVLLDHKAPIIFINQKDTK GQLFTLVHELVHIFVGTEEIFNIVDTGDYQFD+TEA
Sbjct  181  EFRGFVLLDHKAPIIFINQKDTKNGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDQTEA  240

Query  241  FINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDL  300
            FINKVTAEIL P+EI L+LNSTDSNFLARKFKVSEFVIVRRLL+LNKITR+EYL+RTRDL
Sbjct  241  FINKVTAEILVPQEIFLQLNSTDSNFLARKFKVSEFVIVRRLLDLNKITRDEYLSRTRDL  300

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGVGFKGY  360
            +ENLERFLP  SESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNI+GVGFKGY
Sbjct  301  KENLERFLP--SESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIIGVGFKGY  358

Query  361  KILMNRGGND  370
            KILMNRGGND
Sbjct  359  KILMNRGGND  368


> A0A0F4LG35 Peptidase_M78 domain-containing protein [Lactobacillus 
kimbladii]
Length=372

 Score =  404 bits (1039),  Expect = 1e-142
 Identities = 202/368 (55%), Positives = 269/368 (73%), Gaps = 6/368 (2%)

Query  1    MSMRIDTN--TLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTG  58
            M  R+D N  TL YY+ N+ +S   L+ K+ N+D FL G K PTFNQLS+IAK I+VPTG
Sbjct  1    MVTRLDINPHTLAYYIDNSGVSKDYLQMKVQNIDAFLDGSKNPTFNQLSKIAKLIDVPTG  60

Query  59   LLLLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQF  118
            LLLL+  ++ D   L FRT+ S+ I++ S ELRDTI EM+ KQ+FL+NEI   LDF+G++
Sbjct  61   LLLLSDPVEADKNTLKFRTINSNRIEKISNELRDTIVEMQTKQDFLRNEIDYELDFIGKY  120

Query  119  SIDSNFLEVAKKIRNKLEIPLFFQSQAD---NPLNYLRDKINDIGVFVFFNGKVKDNTHR  175
            SI + + +V   IRN L+IP+ +Q  A    N L Y RDK++ IG+F+FFNG VK NTHR
Sbjct  121  SIKNAYQQVVDDIRNYLDIPINYQKNAGKNKNALKYFRDKMSQIGIFIFFNGSVKSNTHR  180

Query  176  PLSVKEFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQF  235
             LS++EFRGFVL D KAPIIF+N KD++ G+LFTLVHELVH+F+  EEIF++VDTG Y+F
Sbjct  181  SLSLEEFRGFVLSDKKAPIIFVNSKDSEAGRLFTLVHELVHLFLDQEEIFSLVDTGSYKF  240

Query  236  DRTEAFINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLN  295
            D TE F+N+VTAEIL P E I KLNS D  FLA +F VS+FVIVR+L ++  +T+ EY  
Sbjct  241  DPTETFVNRVTAEILLPNEEIRKLNSYDIEFLAHEFPVSKFVIVRKLYDMKILTKNEYDE  300

Query  296  RTRDLEENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVNHDRISYTDAFNIVGV  355
            +   L++ L + +P + +S GG+Y NNIRFR D  F  Y+ NA+  ++I+YTDAFNIVGV
Sbjct  301  KVSQLKKELAK-IPPDKKSKGGNYDNNIRFRFDQTFVHYIENAIKQNKITYTDAFNIVGV  359

Query  356  GFKGYKIL  363
             +K +KIL
Sbjct  360  SYKSFKIL  367



Lambda      K        H        a         alpha
   0.322    0.140    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 849546


  Database: 263107dd05fe432f085afc363c3af7cd.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:19 PM
  Number of letters in database: 2,950
  Number of sequences in database:  8



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40