ACIAD3429 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 83b1fb5b13edc424521c7561fbd61b55.SwissProt.fasta
           8 sequences; 5,922 total letters



Query= ACIAD3429

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q80UK7 Spindle assembly abnormal protein 6 homolog [Mus musculus]   40.4    7e-07
  Q08014 Median body protein [Giardia intestinalis]                   40.4    7e-07
  C4R159 Autophagy-related protein 28 [Komagataella phaffii (stra...  38.5    3e-06
  Q5IF00 Autophagy-related protein 28 [Komagataella pastoris]         38.5    3e-06
  Q6UVJ0 Spindle assembly abnormal protein 6 homolog [Homo sapiens]   38.1    4e-06
  P32380 Spindle pole body component 110 [Saccharomyces cerevisia...  37.4    7e-06
  Q46508 NADP-reducing hydrogenase subunit HndD [Desulfovibrio fr...  35.4    3e-05
  Q0TR53 O-GlcNAcase NagJ [Clostridium perfringens (strain ATCC 1...  35.4    3e-05


> Q80UK7 Spindle assembly abnormal protein 6 homolog [Mus musculus]
Length=654

 Score = 40.4 bits (93),  Expect = 7e-07
 Identities = 68/335 (20%), Positives = 139/335 (41%), Gaps = 45/335 (13%)

Query  5    IDTNTLNYYVHNAQISLSVLRTKINNLDQFLSG-------EKQPTFNQLSEIAKKINVPT  57
            ++TN   + +H   +SL +L      + +FL+G       EK      L ++ +++++ T
Sbjct  126  VETNPFKHLIH---LSLKLLPGNDVEIKKFLAGCLKCSKEEKLSLTRSLDDVTRQLHI-T  181

Query  58   GLLLLNKTIDIDIKRLDFRTLESDSIDEASEELR-------DTIAEMEVKQEFLKNEI-T  109
               L  K  ++D  R ++ +  +   ++ S+EL         T  + + + E  K E+ T
Sbjct  182  QETLSEKMQELDKLRSEWASHTASLTNKHSQELTAEKEKALQTQVQCQQQHEQQKKELET  241

Query  110  ENLDFVGQFSIDSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKV  169
             +   + Q     + LE A K   + +       + D+ +  L+ K+  +        ++
Sbjct  242  LHQRNIHQLQSRLSELEAANKELTERKY------KGDSTVRELKAKLAGV------EEEL  289

Query  170  KDNTHRPLSVKEFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIV-  228
            +      LS++     +  +       INQ  TK   L   + +   + + T+E F+ + 
Sbjct  290  QRAKQEVLSLRRENCTLDTECHEKEKHINQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQ  349

Query  229  ----------DTGDYQFDRTEAFINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVI  278
                      +    Q  + EA I  ++AE+L   EII KL   D   L  K K+   V 
Sbjct  350  EQKVALEENGEKNQIQLGKLEATIKSLSAELLKANEIIKKLQG-DLKTLMGKLKLKNTVT  408

Query  279  VRRLLELNKITREEYLNRTRDLEENLERFLPSESE  313
            +++  E     +EE L + R   ++  +FL ++ +
Sbjct  409  IQQ--EKLLAEKEEMLQKERKESQDAGQFLRAKEQ  441


 Score = 26.2 bits (56),  Expect = 0.020
 Identities = 33/141 (23%), Positives = 65/141 (46%), Gaps = 25/141 (18%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQ------PTFNQLSE--IAKK  52
            +S+R +  TL+   H  +  ++ L+TK+  L+Q +  + Q        F+ + E  +A +
Sbjct  297  LSLRRENCTLDTECHEKEKHINQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQEQKVALE  356

Query  53   INVPTGLLLLNKTIDIDIKRLDFRTLESDSIDEASE----------ELRDTIAEME----  98
             N     + L K ++  IK L    L+++ I +  +          +L++T+   +    
Sbjct  357  ENGEKNQIQLGK-LEATIKSLSAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEKLL  415

Query  99   -VKQEFLKNEITENLDFVGQF  118
              K+E L+ E  E+ D  GQF
Sbjct  416  AEKEEMLQKERKESQD-AGQF  435


 Score = 24.6 bits (52),  Expect = 0.061
 Identities = 20/93 (22%), Positives = 40/93 (43%), Gaps = 7/93 (8%)

Query  20   SLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLLLLNKTIDIDIKRLD-----  74
            SLS    K N + + L G+ +    +L ++   + +    LL  K   +  +R +     
Sbjct  375  SLSAELLKANEIIKKLQGDLKTLMGKL-KLKNTVTIQQEKLLAEKEEMLQKERKESQDAG  433

Query  75   -FRTLESDSIDEASEELRDTIAEMEVKQEFLKN  106
             F   +   +    E+L  T+ ++E  ++ LKN
Sbjct  434  QFLRAKEQEVCRLQEQLETTVQKLEESKQLLKN  466


> Q08014 Median body protein [Giardia intestinalis]
Length=857

 Score = 40.4 bits (93),  Expect = 7e-07
 Identities = 24/90 (27%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query  5    IDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLLLLNK  64
            +D +TL       ++ L+ L+ K+NN DQ L+ +K     QL E++ K+     ++  N+
Sbjct  699  MDVDTLVEEKQRLEMRLAELKIKVNNYDQ-LADDKARLQEQLKEMSDKLIEFEMIMDDNR  757

Query  65   TIDIDIKRLDFRTLESDSIDEASEELRDTI  94
             + + +K LD +T   + + E  ++L D +
Sbjct  758  RLKLQVKELDLKTANMEKLYEEYKKLEDQL  787


 Score = 31.6 bits (70),  Expect = 4e-04
 Identities = 22/102 (22%), Positives = 51/102 (50%), Gaps = 4/102 (4%)

Query  2    SMRIDTNTLNYYVHNAQI---SLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTG  58
            ++R   N L+ Y    Q     +++LR K    D+ L  + +    +L+E+ +K+ +   
Sbjct  621  ALREKANELDGYNRERQAREHEINMLRDKALESDK-LRQDNRVMAMELTELREKVQLLEK  679

Query  59   LLLLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVK  100
            L    +  D+++  L  + ++ D++ E  + L   +AE+++K
Sbjct  680  LQYEKRARDVEMLELRHKAMDVDTLVEEKQRLEMRLAELKIK  721


 Score = 22.3 bits (46),  Expect = 0.33
 Identities = 28/122 (23%), Positives = 43/122 (35%), Gaps = 18/122 (15%)

Query  45   QLSEIAKKINVPTGLLLLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFL  104
            QL E  ++ +     L   + ++ +IK L  R  E+D   E S                L
Sbjct  343  QLHEALERADAGEAALRDKRRLEDEIKGLQLRLTENDFTKERS---------------IL  387

Query  105  KNEITENLDFVGQFSIDSNFLEVAKKIRNKLEIP--LFFQSQADNPLNYLRDKINDIGVF  162
            +NEI      +     D   LE  K +  + E+   L+ +      LN  R    DI   
Sbjct  388  RNEIQAKTTEIDTLISDRRALE-TKLLNKEAEVDQLLYEKQLLKTELNSYRGTNEDIDKL  446

Query  163  VF  164
             F
Sbjct  447  TF  448


 Score = 18.1 bits (35),  Expect = 6.7
 Identities = 15/85 (18%), Positives = 36/85 (42%), Gaps = 9/85 (11%)

Query  61   LLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFL---------KNEITEN  111
            L+ +  D++    D R    D+     +E+    AE+E ++  L         ++E+   
Sbjct  172  LVQEKRDLERHLADLRLSRQDTNSRLPQEIDRLRAEIEDEKRNLPHMDDLQRQRDELQRQ  231

Query  112  LDFVGQFSIDSNFLEVAKKIRNKLE  136
            LD + +    S  +   + I+ +++
Sbjct  232  LDTIRRRGNTSGVMAEIENIQRQID  256


> C4R159 Autophagy-related protein 28 [Komagataella phaffii (strain 
GS115 / ATCC 20864)]
Length=612

 Score = 38.5 bits (88),  Expect = 3e-06
 Identities = 38/142 (27%), Positives = 69/142 (49%), Gaps = 8/142 (6%)

Query  21   LSVLRTKINNLDQFLSGEKQPTFNQLSEIA--KKINVPTGLLLLNKTIDIDIKRLDFRTL  78
            LS++ + I N  Q  + +KQ   +++ E    KK  +     +L+   + D +   F  L
Sbjct  203  LSLVLSSIFNTYQAKAQDKQAILDKIEEWEDEKKSLLDDMKEVLSTDDNADGETHKFLEL  262

Query  79   ESDSIDEASE--ELRDTIAEMEVKQEFLKNEITENLDFVGQFSIDSNFLEVAKKI--RNK  134
             S+SI+  +E   L   + ++++KQ  LKNE  ++   +   S  SNF++  +KI  R +
Sbjct  263  ASESINVENEIEALETRLKQLKIKQRTLKNECFQSQGIIE--SRLSNFVQAVEKIEMRER  320

Query  135  LEIPLFFQSQADNPLNYLRDKI  156
              I    Q  ++N L Y  D +
Sbjct  321  KSIEQVVQQLSENQLGYWNDNL  342


 Score = 21.9 bits (45),  Expect = 0.42
 Identities = 9/29 (31%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDN  329
            E++ +  L  +SE++  S T+  +F+V+N
Sbjct  107  EDSEDELLIPDSENHNSSSTSPRKFKVEN  135


> Q5IF00 Autophagy-related protein 28 [Komagataella pastoris]
Length=612

 Score = 38.5 bits (88),  Expect = 3e-06
 Identities = 38/142 (27%), Positives = 69/142 (49%), Gaps = 8/142 (6%)

Query  21   LSVLRTKINNLDQFLSGEKQPTFNQLSEIA--KKINVPTGLLLLNKTIDIDIKRLDFRTL  78
            LS++ + I N  Q  + +KQ   +++ E    KK  +     +L+   + D +   F  L
Sbjct  203  LSLVLSSIFNTYQAKAQDKQAILDKIEEWEDEKKSLLDDMKEVLSTDDNADGETHKFLEL  262

Query  79   ESDSIDEASE--ELRDTIAEMEVKQEFLKNEITENLDFVGQFSIDSNFLEVAKKI--RNK  134
             S+SI+  +E   L   + ++++KQ  LKNE  ++   +   S  SNF++  +KI  R +
Sbjct  263  ASESINVENEIEALETRLKQLKIKQRTLKNECFQSQGIIE--SRLSNFVQAVEKIEMRER  320

Query  135  LEIPLFFQSQADNPLNYLRDKI  156
              I    Q  ++N L Y  D +
Sbjct  321  KSIEQVVQQLSENQLGYWNDNL  342


 Score = 21.9 bits (45),  Expect = 0.42
 Identities = 9/29 (31%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  301  EENLERFLPSESESNGGSYTNNIRFRVDN  329
            E++ +  L  +SE++  S T+  +F+V+N
Sbjct  107  EDSEDELLIPDSENHNSSSTSPRKFKVEN  135


> Q6UVJ0 Spindle assembly abnormal protein 6 homolog [Homo sapiens]
Length=657

 Score = 38.1 bits (87),  Expect = 4e-06
 Identities = 59/303 (19%), Positives = 127/303 (42%), Gaps = 43/303 (14%)

Query  5    IDTNTLNYYVHNAQISLSVLRTKINNLDQFLSG-------EKQPTFNQLSEIAKKINVPT  57
            ++TN   +  H   +SL +L      + +FL+G       EK      L +  K+++  T
Sbjct  126  VETNPFKHLTH---LSLKLLPGNDVEIKKFLAGCLKCSKEEKLSLMQSLDDATKQLDF-T  181

Query  58   GLLLLNKTIDIDIKRLDFRTLESDSIDEASEEL---RDTIAEMEVKQEFLKNEITENLDF  114
               L  K  ++D  R ++ +  +   ++ S+EL   ++   + +V+ +    +  ++L+ 
Sbjct  182  RKTLAEKKQELDKLRNEWASHTAALTNKHSQELTNEKEKALQAQVQYQQQHEQQKKDLEI  241

Query  115  VGQFSIDS-----NFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKINDIGVFVFFNGKV  169
            + Q +I       + LE A K   + +       + D+ +  L+ K++ +        ++
Sbjct  242  LHQQNIHQLQNRLSELEAANKDLTERKY------KGDSTIRELKAKLSGV------EEEL  289

Query  170  KDNTHRPLSVKEFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIV-  228
            +      LS++     + ++       +NQ  TK   L   + +   + + T+E F+ + 
Sbjct  290  QRTKQEVLSLRRENSTLDVECHEKEKHVNQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQ  349

Query  229  ----------DTGDYQFDRTEAFINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVI  278
                      +    Q  + EA I  ++AE+L   EII KL   D   L  K K+   V 
Sbjct  350  EQKVVLEENGEKNQVQLGKLEATIKSLSAELLKANEIIKKLQG-DLKTLMGKLKLKNTVT  408

Query  279  VRR  281
            +++
Sbjct  409  IQQ  411


 Score = 24.3 bits (51),  Expect = 0.080
 Identities = 11/40 (28%), Positives = 24/40 (60%), Gaps = 0/40 (0%)

Query  1    MSMRIDTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQ  40
            +S+R + +TL+   H  +  ++ L+TK+  L+Q +  + Q
Sbjct  297  LSLRRENSTLDVECHEKEKHVNQLQTKVAVLEQEIKDKDQ  336


 Score = 23.9 bits (50),  Expect = 0.11
 Identities = 18/93 (19%), Positives = 42/93 (45%), Gaps = 7/93 (8%)

Query  20   SLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLLLLNKTIDIDIKRLDFRT--  77
            SLS    K N + + L G+ +    +L ++   + +    LL  K   +  ++ + +   
Sbjct  375  SLSAELLKANEIIKKLQGDLKTLMGKL-KLKNTVTIQQEKLLAEKEEKLQKEQKELQDVG  433

Query  78   ----LESDSIDEASEELRDTIAEMEVKQEFLKN  106
                ++   + +  E+L  T+ ++E  ++ LKN
Sbjct  434  QSLRIKEQEVCKLQEQLEATVKKLEESKQLLKN  466


> P32380 Spindle pole body component 110 [Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c)]
Length=944

 Score = 37.4 bits (85),  Expect = 7e-06
 Identities = 60/294 (20%), Positives = 116/294 (39%), Gaps = 44/294 (15%)

Query  38   EKQPTFNQLSEIAKKIN-VPTGLLLLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAE  96
            E++    +L+E+ +K+  V   +L L    D+   +L  +  E  ++     EL+    E
Sbjct  228  EREQMERKLAELERKLKTVKDQVLELENNSDVQSLKLRSKEDELKNLMNELNELKSNAEE  287

Query  97   MEVKQEFLKNEITENLDFVGQFSIDSNFLEVAKKIRNKLEIPLFFQSQADNPLNYLRDKI  156
             + + EF KNE+ +  + + +  I S+ +++  K             Q  N    L+D++
Sbjct  288  KDTQLEFKKNELRKRTNELNELKIKSDEMDLQLK-------------QKQNESKRLKDEL  334

Query  157  NDIGVFVFFNGKVKDNTHRPLSVKEFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVH  216
            N++      NG          S KE    +L +  A +    +  TK  QL     +L  
Sbjct  335  NELETKFSENGSQS-------SAKENELKMLKNKIAEL--EEEISTKNSQLIAKEGKLAS  385

Query  217  IFVGTEEIFNIVDTGDYQFDRTEAFINKVTAEI-----LAPREIILKLNSTDSNFLARKF  271
            +     ++ + ++  D Q    E  + K   ++     +A  E +    S D   +  + 
Sbjct  386  LMAQLTQLESKLNQRDSQLGSREEELKKTNDKLQKDIRIAREETV----SKDERIIDLQK  441

Query  272  KVSE-----FVIVRRLLELNKITREEYLNRTR-------DLEENLERFLPSESE  313
            KV +     FVI +   E   IT  E  ++ +       DL+   E++   E E
Sbjct  442  KVKQLENDLFVIKKTHSESKTITDNELESKDKLIKILENDLKVAQEKYSKMEKE  495


 Score = 23.5 bits (49),  Expect = 0.14
 Identities = 25/144 (17%), Positives = 52/144 (36%), Gaps = 19/144 (13%)

Query  197  INQKDTKTGQLFTLVHELVHIFVGTEEIFNIVDTGDYQFDRTEAFINKVTAEILAPREII  256
            I+ K+    ++ +L HE+  +     +  N  DT + + D  +  +  +  E+ A  +I+
Sbjct  155  ISNKELYINEIKSLKHEIKELRKEKNDTLNNYDTLEEETDDLKNRLQALEKELDAKNKIV  214

Query  257  LKLNSTDSNFLARKFKVSEFVIVRRLLELNKITREEYLNRTRDLEENLERFLPSESESNG  316
                  D +    +                   RE+   +  +LE  L+       E   
Sbjct  215  NSRKVDDHSGCIEE-------------------REQMERKLAELERKLKTVKDQVLELEN  255

Query  317  GSYTNNIRFRVDNKFFKYVMNAVN  340
             S   +++ R      K +MN +N
Sbjct  256  NSDVQSLKLRSKEDELKNLMNELN  279


 Score = 21.9 bits (45),  Expect = 0.43
 Identities = 74/366 (20%), Positives = 140/366 (38%), Gaps = 71/366 (19%)

Query  21   LSVLRTKINNLDQFLS----------GEKQPTFNQLSEIAKKINVPTGLL-----LLNKT  65
            L +L+ KI  L++ +S          G+      QL+++  K+N     L      L KT
Sbjct  355  LKMLKNKIAELEEEISTKNSQLIAKEGKLASLMAQLTQLESKLNQRDSQLGSREEELKKT  414

Query  66   IDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQ--------  117
             D   K +     E+ S DE   +L+  + ++E     +K   +E+              
Sbjct  415  NDKLQKDIRIAREETVSKDERIIDLQKKVKQLENDLFVIKKTHSESKTITDNELESKDKL  474

Query  118  FSIDSNFLEVAKKIRNKLEIPL--------FFQSQADNPLNYLRDKINDIGVFVF-FNGK  168
              I  N L+VA++  +K+E  L          +S+ ++    L +KI+++         K
Sbjct  475  IKILENDLKVAQEKYSKMEKELKEREFNYKISESKLEDEKTTLNEKISNLAAENSQLKNK  534

Query  169  VKDNTHRPLSVKEFRGFVLLDHKAPIIFINQKDTKTGQLFTLVHELVHIFVGTEEIFNIV  228
            ++DN+     +KE                        QL +L  ++       EE     
Sbjct  535  IEDNSTATHHMKE--------------------NYEKQLESLRKDI-------EEYKESA  567

Query  229  DTGDYQFDRTEAFINKVTAEILAPREIILKLNSTDSNFLARKFKVSE-------FVIVRR  281
               + + +  +  I + +A++   R   +K      + L +  K+ E        +I R 
Sbjct  568  KDSEDKIEELKIRIAENSAKVSEKRSKDIKQKDEQISDLTQNLKLQEDEISSLKSIIDRY  627

Query  282  LLELNKITREEYLNRTRDLEE---NLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNA  338
              + N++ + E  N   DL     NLE  L  ESE    S  ++ +  ++N   KY   +
Sbjct  628  KKDFNQL-KSEQSNIQHDLNLQILNLENKL-IESEDELKSLRDSQKIEIENWKRKYNNLS  685

Query  339  VNHDRI  344
            + +DR+
Sbjct  686  LENDRL  691


 Score = 20.0 bits (40),  Expect = 1.7
 Identities = 23/95 (24%), Positives = 34/95 (36%), Gaps = 20/95 (21%)

Query  6    DTNTLNYYVHNAQISLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLLLLNKT  65
            +  TLN  + N     S L+ KI +        K+    QL  + K I            
Sbjct  513  EKTTLNEKISNLAAENSQLKNKIEDNSTATHHMKENYEKQLESLRKDIE-----------  561

Query  66   IDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVK  100
                    +++    DS D+  EEL+  IAE   K
Sbjct  562  --------EYKESAKDSEDKI-EELKIRIAENSAK  587


 Score = 17.7 bits (34),  Expect = 8.9
 Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query  20   SLSVLRTKINNLDQFLSGEKQPTFNQLSEIAKKINVPTGLLLLN  63
            +L +   +I++L   +   K+  FNQL      I     L +LN
Sbjct  609  NLKLQEDEISSLKSIIDRYKKD-FNQLKSEQSNIQHDLNLQILN  651


> Q46508 NADP-reducing hydrogenase subunit HndD [Desulfovibrio 
fructosivorans]
Length=585

 Score = 35.4 bits (80),  Expect = 3e-05
 Identities = 28/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query  51   KKINVPTGLLLLN--KTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEI  108
            K  +VP G  +L+  KT+DIDI  L +  LE+ SI+  +   R  + E+E ++    +  
Sbjct  11   KTTSVPEGSTILDAAKTLDIDIPTLCYLNLEALSINNKAASCRVCVVEVEGRRNLAPSCA  70

Query  109  TENLDFVGQFSIDSNFLEVAKKIRNKLEIPL  139
            T   D      + +N L V    R  LE+ L
Sbjct  71   TPVTD---NMVVKTNSLRVLNARRTVLELLL  98


> Q0TR53 O-GlcNAcase NagJ [Clostridium perfringens (strain ATCC 
13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type 
A)]
Length=1001

 Score = 35.4 bits (80),  Expect = 3e-05
 Identities = 50/196 (26%), Positives = 85/196 (43%), Gaps = 25/196 (13%)

Query  55   VPTGLLLLNKTID-IDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLD  113
            V TG L  N  I  I+   +D + +  D  D  S++           +  +  ++ EN +
Sbjct  715  VKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHGKLKENAE  774

Query  114  FVGQFSIDS-NFLEVAKKIRNKLEIPLFFQSQA---DNPLNYLR------DKINDIGVFV  163
              G  S+++   ++V + +   + I     ++A   D  LNY        + I+D GVFV
Sbjct  775  VTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFV  834

Query  164  ----FFNGKVK----DNTHRPLSVKEFRGFVLL--DHKAPIIFINQKDTKTGQLFTLVHE  213
                  +GKV+      T  PL  KE    V+L  + KA    ++  ++  G    LVHE
Sbjct  835  NAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHE  894

Query  214  LVHIFVGTEEIFNIVD  229
            +     GTE+  NI++
Sbjct  895  IA----GTEKTVNIIE  906


 Score = 22.3 bits (46),  Expect = 0.33
 Identities = 26/124 (21%), Positives = 50/124 (40%), Gaps = 3/124 (2%)

Query  223  EIFNIVDTGDYQFDRTEAFINKVTAEILAPREIILKLNSTDSNFLARKFKVSEFVIVRRL  282
            E F  V TG  + +    FI   + +    R  +    S  +N   +    +E  +  +L
Sbjct  710  ENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHGKL  769

Query  283  LELNKITREEYLNRTRDLE--ENLERFLPSESESNGGSYTNNIRFRVDNKFFKYVMNAVN  340
             E  ++T    L    +++  ENLE  +  +   N  ++  +     D   F+YV  A++
Sbjct  770  KENAEVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYV-EAIS  828

Query  341  HDRI  344
             D +
Sbjct  829  DDGV  832


 Score = 21.2 bits (43),  Expect = 0.75
 Identities = 23/100 (23%), Positives = 38/100 (38%), Gaps = 1/100 (1%)

Query  222  EEIFNIVDTGDYQFDRTEAFINKVTAEILAPREIIL-KLNSTDSNFLARKFKVSEFVIVR  280
            +E+  +        D   A +N+ T    + +EI   KLN+  S+F     KV++  I  
Sbjct  556  DELITLAQGDKASLDMIVAQLNEDTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQE  615

Query  281  RLLELNKITREEYLNRTRDLEENLERFLPSESESNGGSYT  320
             L     +     +  T   EE      P+   S+G   T
Sbjct  616  ALSFDLTLINPRTVKITASSEETSGENAPASFASDGDMNT  655


 Score = 20.4 bits (41),  Expect = 1.3
 Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query  59   LLLLNKTIDIDIKRLDFRTLESDSIDEASEELRDTIAEMEVKQEFLKNEITENLDFVGQF  118
            + + N  I   ++ +  +T E + +      L  T   +EV  +  K  IT +++ VG+ 
Sbjct  17   MFIANGLITTTVRAVGPKTGEENQV--LVPNLNPTPENLEVVGDGFK--ITSSINLVGEE  72

Query  119  SIDSNFLEVAKKI--RNKLEI  137
              D N +   ++    N +EI
Sbjct  73   EADENAVNALREFLTANNIEI  93


 Score = 17.7 bits (34),  Expect = 8.9
 Identities = 7/21 (33%), Positives = 11/21 (52%), Gaps = 0/21 (0%)

Query  95   AEMEVKQEFLKNEITENLDFV  115
            +EM+  QE +       +DFV
Sbjct  234  SEMQRMQELINASAENKVDFV  254



Lambda      K        H        a         alpha
   0.322    0.140    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1780660


  Database: 83b1fb5b13edc424521c7561fbd61b55.SwissProt.fasta
    Posted date:  Sep 26, 2020  7:42 PM
  Number of letters in database: 5,922
  Number of sequences in database:  8



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40