ACIAD3537 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: a661af178d6da41b81b1dbb37e8e5d64.TrEMBL.fasta
           19 sequences; 3,430 total letters



Query= ACIAD3537

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F6Y5 OHCU_decarbox domain-containing protein [Acinetobacter b...   336    3e-122
  A0A1P8EKN9 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarb...   258    3e-91 
  A0A0M1I7K5 OHCU decarboxylase [Acinetobacter sp. C15]                258    3e-91 
  N9AK36 OHCU decarboxylase [Acinetobacter soli NIPH 2899]             258    3e-91 
  A0A009ZG61 OHCU_decarbox domain-containing protein [Acinetobact...   246    9e-87 
  N9BY39 OHCU decarboxylase [Acinetobacter ursingii ANC 3649]          245    3e-86 
  N9SE74 OHCU decarboxylase [Acinetobacter ursingii NIPH 706]          244    5e-86 
  R8Y021 OHCU decarboxylase [Acinetobacter calcoaceticus ANC 3811]     201    3e-69 
  N9RYJ4 OHCU decarboxylase [Acinetobacter sp. NIPH 542]               201    4e-69 
  D8JKY9 Putative OHCU decarboxylase [Acinetobacter oleivorans (s...   201    4e-69 
  A0A1Y5NRU5 OHCU decarboxylase [Acinetobacter nosocomialis P020]      201    6e-69 
  L9LRY5 OHCU decarboxylase [Acinetobacter sp. OIFC021]                201    6e-69 
  S3TQ89 OHCU decarboxylase [Acinetobacter baumannii NIPH 410]         200    1e-68 
  A0A0E2GFI9 OHCU decarboxylase [Acinetobacter nosocomialis NIPH ...   199    2e-68 
  B6D1N6 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxyl...   122    3e-38 
  A6T925 OHCU_decarbox domain-containing protein [Klebsiella pneu...   119    3e-37 
  D8V0F4 Cytosolic S-allantoin synthase splice variant 2 [Arabido...  51.6    8e-12 
  D8V0F3 Peroxisomal S-allantoin synthase splice variant 1 [Arabi...  51.6    8e-12 
  Q0ZD39 Parahox neighbor [Polypterus senegalus]                      37.4    2e-07 


> Q6F6Y5 OHCU_decarbox domain-containing protein [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=167

 Score =  336 bits (862),  Expect = 3e-122
 Identities = 166/167 (99%), Positives = 167/167 (100%), Gaps = 0/167 (0%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            +RFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH
Sbjct  1    MRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120
            AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI
Sbjct  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120

Query  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIEP  167
            KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIEP
Sbjct  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIEP  167


> A0A1P8EKN9 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 
[Acinetobacter soli]
Length=170

 Score =  258 bits (658),  Expect = 3e-91
 Identities = 127/167 (76%), Positives = 141/167 (84%), Gaps = 0/167 (0%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            VRFS+FN AP DDA  VL ACVHIPSW  TL QQRPY SR+ L  +A  Q + W+W DI 
Sbjct  4    VRFSEFNAAPIDDAKTVLHACVHIPSWTQTLSQQRPYSSRDELLSTAANQAERWTWQDIE  63

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120
            AALATHPRIGEKKAKQ LTERE  FSD+EQSGVKQD+ TQ+AL EGNMAYE+KFGFIFLI
Sbjct  64   AALATHPRIGEKKAKQALTEREAAFSDAEQSGVKQDETTQRALFEGNMAYEEKFGFIFLI  123

Query  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIEP  167
            KAAGLSSD ML+AL QRL+HD++TEK IVH+QLAAIALLRLSQGIEP
Sbjct  124  KAAGLSSDQMLSALNQRLSHDIDTEKQIVHEQLAAIALLRLSQGIEP  170


> A0A0M1I7K5 OHCU decarboxylase [Acinetobacter sp. C15]
Length=170

 Score =  258 bits (658),  Expect = 3e-91
 Identities = 127/167 (76%), Positives = 141/167 (84%), Gaps = 0/167 (0%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            VRFS+FN AP DDA  VL ACVHIPSW  TL QQRPY SR+ L  +A  Q + W+W DI 
Sbjct  4    VRFSEFNAAPIDDAKTVLHACVHIPSWTQTLSQQRPYSSRDELLSTAANQAERWTWQDIE  63

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120
            AALATHPRIGEKKAKQ LTERE  FSD+EQSGVKQD+ TQ+AL EGNMAYE+KFGFIFLI
Sbjct  64   AALATHPRIGEKKAKQALTEREAAFSDAEQSGVKQDETTQRALFEGNMAYEEKFGFIFLI  123

Query  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIEP  167
            KAAGLSSD ML+AL QRL+HD++TEK IVH+QLAAIALLRLSQGIEP
Sbjct  124  KAAGLSSDQMLSALNQRLSHDIDTEKQIVHEQLAAIALLRLSQGIEP  170


> N9AK36 OHCU decarboxylase [Acinetobacter soli NIPH 2899]
Length=170

 Score =  258 bits (658),  Expect = 3e-91
 Identities = 127/167 (76%), Positives = 141/167 (84%), Gaps = 0/167 (0%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            VRFS+FN AP DDA  VL ACVHIPSW  TL QQRPY SR+ L  +A  Q + W+W DI 
Sbjct  4    VRFSEFNAAPIDDAKTVLHACVHIPSWTQTLSQQRPYSSRDELLSTAANQAERWTWQDIE  63

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120
            AALATHPRIGEKKAKQ LTERE  FSD+EQSGVKQD+ TQ+AL EGNMAYE+KFGFIFLI
Sbjct  64   AALATHPRIGEKKAKQALTEREAAFSDAEQSGVKQDETTQRALFEGNMAYEEKFGFIFLI  123

Query  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIEP  167
            KAAGLSSD ML+AL QRL+HD++TEK IVH+QLAAIALLRLSQGIEP
Sbjct  124  KAAGLSSDQMLSALNQRLSHDIDTEKQIVHEQLAAIALLRLSQGIEP  170


> A0A009ZG61 OHCU_decarbox domain-containing protein [Acinetobacter 
sp. 479375]
Length=168

 Score =  246 bits (628),  Expect = 9e-87
 Identities = 122/166 (73%), Positives = 139/166 (84%), Gaps = 0/166 (0%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            V FS+FN A +     +LSACVHIPSWI+TL QQRPY S + L D A QQ+QNW+W +I 
Sbjct  2    VHFSEFNHAAAHQVTPLLSACVHIPSWIDTLSQQRPYASAQNLMDLAAQQSQNWTWTEIE  61

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120
             ALATHPRIGEKKAK +LTE+E  FSD EQSGVKQD+YTQ+AL EGN+AYEQKFGFIFLI
Sbjct  62   TALATHPRIGEKKAKVELTEQEANFSDREQSGVKQDEYTQRALFEGNVAYEQKFGFIFLI  121

Query  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            KAAGLSS+ +L ALQQRL HDLETEK IVH+QLAAIALLRLSQGI+
Sbjct  122  KAAGLSSEQILCALQQRLQHDLETEKKIVHEQLAAIALLRLSQGIQ  167


> N9BY39 OHCU decarboxylase [Acinetobacter ursingii ANC 3649]
Length=168

 Score =  245 bits (625),  Expect = 3e-86
 Identities = 122/166 (73%), Positives = 139/166 (84%), Gaps = 0/166 (0%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            V FS+FN A +     +LSACVHIPSWI+TL QQRPY S + L D A QQ+QNW+W +I 
Sbjct  2    VHFSEFNHASAHQVTPLLSACVHIPSWIDTLSQQRPYASAQNLMDLAAQQSQNWTWTEIV  61

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120
             ALATHPRIGEKKAK +LTE+E  FSD EQSGVKQD+YTQ+AL EGN+AYEQKFGFIFLI
Sbjct  62   TALATHPRIGEKKAKVELTEQEANFSDREQSGVKQDEYTQRALFEGNVAYEQKFGFIFLI  121

Query  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            KAAGLSS+ +L ALQQRL HDLETEK IVH+QLAAIALLRLSQGI+
Sbjct  122  KAAGLSSEQILCALQQRLQHDLETEKKIVHEQLAAIALLRLSQGIQ  167


> N9SE74 OHCU decarboxylase [Acinetobacter ursingii NIPH 706]
Length=168

 Score =  244 bits (623),  Expect = 5e-86
 Identities = 121/166 (73%), Positives = 139/166 (84%), Gaps = 0/166 (0%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            V FS+FN A +     +LSACVHI SWI+TL QQRPY S + L D A QQ+QNW+W +I 
Sbjct  2    VHFSEFNHAAAYQVTPLLSACVHISSWIDTLSQQRPYASAQSLMDLAAQQSQNWTWTEIE  61

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLI  120
             ALATHPRIGEKKAK +LTE+E  FSD EQSGVKQD+YTQ+AL EGN+AYEQKFGFIFLI
Sbjct  62   TALATHPRIGEKKAKVELTEQEANFSDREQSGVKQDEYTQRALFEGNVAYEQKFGFIFLI  121

Query  121  KAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            KAAGLSS+ +L+ALQQRL HDLETEK IVH+QLAAIALLRLSQGI+
Sbjct  122  KAAGLSSEQILSALQQRLQHDLETEKKIVHEQLAAIALLRLSQGIQ  167


> R8Y021 OHCU decarboxylase [Acinetobacter calcoaceticus ANC 3811]
Length=167

 Score =  201 bits (512),  Expect = 3e-69
 Identities = 96/163 (59%), Positives = 122/163 (75%), Gaps = 0/163 (0%)

Query  4    SDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAAL  63
            ++FN AP +    +L  CVHIP+W   +  +RPY +R  L D A   +Q WSW DI  AL
Sbjct  4    AEFNQAPPEQLKTLLKNCVHIPAWAEKIISERPYSTRASLLDHADNLSQMWSWQDIETAL  63

Query  64   ATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAA  123
            ATHP+IGE++AK+QL  +E+ FS+ EQ+G+  D+ TQQALL+GN+ YEQKFGFIFLIKAA
Sbjct  64   ATHPKIGERQAKKQLNAKEQHFSNQEQAGISLDEQTQQALLQGNLDYEQKFGFIFLIKAA  123

Query  124  GLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            GLSSD++L  L +RL HDL  EK IVH+QLAAIALLRLSQ I+
Sbjct  124  GLSSDEILKKLHERLQHDLAIEKVIVHEQLAAIALLRLSQEIQ  166


> N9RYJ4 OHCU decarboxylase [Acinetobacter sp. NIPH 542]
Length=167

 Score =  201 bits (511),  Expect = 4e-69
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 0/163 (0%)

Query  4    SDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAAL  63
            ++FN AP +    +L  CVHIP+W   +   RPY S+  L + A+  +Q WSW DI  AL
Sbjct  4    AEFNQAPPEQLKTLLKNCVHIPAWAEKITSGRPYSSKASLLEHAENLSQMWSWQDIETAL  63

Query  64   ATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAA  123
            ATHP+IGE++AK+QL  +E+ FS+ EQ+G+  D+ TQQALL+GN+ YEQKFGFIFLIKAA
Sbjct  64   ATHPKIGERQAKKQLNAKEQHFSNQEQAGISLDEQTQQALLQGNLDYEQKFGFIFLIKAA  123

Query  124  GLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            GLSSD++L  LQ+RL HDL  EK IVHQQL+AIALLRLSQ I+
Sbjct  124  GLSSDEILKKLQERLQHDLAIEKVIVHQQLSAIALLRLSQEIQ  166


> D8JKY9 Putative OHCU decarboxylase [Acinetobacter oleivorans 
(strain JCM 16667 / KCTC 23045 / DR1)]
Length=167

 Score =  201 bits (511),  Expect = 4e-69
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 0/163 (0%)

Query  4    SDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAAL  63
            ++FN AP +    +L  CVHIP+W   +   RPY S+  L + A+  +Q WSW DI  AL
Sbjct  4    AEFNQAPPEQLKTLLKNCVHIPAWAEKITSGRPYSSKASLLEHAENLSQMWSWQDIETAL  63

Query  64   ATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAA  123
            ATHP+IGE++AK+QL  +E+ FS+ EQ+G+  D+ TQQALL+GN+ YEQKFGFIFLIKAA
Sbjct  64   ATHPKIGERQAKKQLNAKEQHFSNQEQAGISLDEQTQQALLQGNLDYEQKFGFIFLIKAA  123

Query  124  GLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            GLSSD++L  LQ+RL HDL  EK IVHQQL+AIALLRLSQ I+
Sbjct  124  GLSSDEILKKLQERLQHDLAIEKVIVHQQLSAIALLRLSQEIQ  166


> A0A1Y5NRU5 OHCU decarboxylase [Acinetobacter nosocomialis P020]
Length=167

 Score =  201 bits (510),  Expect = 6e-69
 Identities = 95/163 (58%), Positives = 125/163 (77%), Gaps = 0/163 (0%)

Query  4    SDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAAL  63
            ++FN APS+    +L+ CVHIP+W   +  +RPY S+ VL   A+Q +  WSW +I AAL
Sbjct  4    AEFNQAPSEQLKTLLNNCVHIPAWAEKIISERPYSSKSVLLGHAEQLSHTWSWQEIQAAL  63

Query  64   ATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAA  123
            ATHP+IGE++AK+QL  +E+ FS  EQ+G+  D+ TQQALL+GN+ YEQKFGFIFLIKAA
Sbjct  64   ATHPKIGERQAKKQLNAKEQDFSAKEQAGISLDEQTQQALLQGNLEYEQKFGFIFLIKAA  123

Query  124  GLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            GLSS+D+L  L QRL ++L  EK IVH+QLAAIALLRLSQ ++
Sbjct  124  GLSSEDILKKLHQRLQNNLAIEKVIVHEQLAAIALLRLSQEVQ  166


> L9LRY5 OHCU decarboxylase [Acinetobacter sp. OIFC021]
Length=167

 Score =  201 bits (510),  Expect = 6e-69
 Identities = 95/163 (58%), Positives = 125/163 (77%), Gaps = 0/163 (0%)

Query  4    SDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAAL  63
            ++FN APS+    +L+ CVHIP+W   +  +RPY S+ VL   A+Q +  WSW +I AAL
Sbjct  4    AEFNQAPSEQLKTLLNNCVHIPAWAEKIISERPYSSKSVLLGHAEQLSHTWSWQEIQAAL  63

Query  64   ATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAA  123
            ATHP+IGE++AK+QL  +E+ FS  EQ+G+  D+ TQQALL+GN+ YEQKFGFIFLIKAA
Sbjct  64   ATHPKIGERQAKKQLNAKEQDFSAKEQAGISLDEQTQQALLQGNLEYEQKFGFIFLIKAA  123

Query  124  GLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            GLSS+D+L  L QRL ++L  EK IVH+QLAAIALLRLSQ ++
Sbjct  124  GLSSEDILKKLHQRLQNNLAIEKVIVHEQLAAIALLRLSQEVQ  166


> S3TQ89 OHCU decarboxylase [Acinetobacter baumannii NIPH 410]
Length=167

 Score =  200 bits (508),  Expect = 1e-68
 Identities = 96/163 (59%), Positives = 122/163 (75%), Gaps = 0/163 (0%)

Query  4    SDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAAL  63
            ++FN AP D    +L+ CVHIP W   +  +RPY S  VL   A+Q +  WSW +I AAL
Sbjct  4    AEFNQAPPDQLKTLLNNCVHIPVWAEKIISERPYSSTSVLLGYAEQLSHTWSWQEIQAAL  63

Query  64   ATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAA  123
            ATHPRIGE++AK+QL  +E+ FS  EQ+G+  D+ TQQALL+GN+ YEQKFGFIFLIKAA
Sbjct  64   ATHPRIGERQAKKQLNAKEQNFSAQEQAGISLDEQTQQALLQGNIEYEQKFGFIFLIKAA  123

Query  124  GLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            GLSSD++L  L QRL ++L  EK IVH+QLAAIALLRLSQ ++
Sbjct  124  GLSSDEILKKLHQRLQNNLAIEKTIVHEQLAAIALLRLSQEVQ  166


> A0A0E2GFI9 OHCU decarboxylase [Acinetobacter nosocomialis NIPH 
386]
Length=167

 Score =  199 bits (507),  Expect = 2e-68
 Identities = 95/163 (58%), Positives = 124/163 (76%), Gaps = 0/163 (0%)

Query  4    SDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAAL  63
            ++FN APS+    +L+ CVHIP+W   +  +RPY S  VL   A+Q +  WSW +I AAL
Sbjct  4    AEFNQAPSEQLKTLLNNCVHIPAWAEKIISERPYSSTSVLLGHAEQLSHTWSWQEIQAAL  63

Query  64   ATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAA  123
            ATHP+IGE++AK+QL  +E+ FS  EQ+G+  D+ TQQALL+GN+ YEQKFGFIFLIKAA
Sbjct  64   ATHPKIGERQAKKQLNAKEQDFSAKEQAGISLDEQTQQALLQGNLEYEQKFGFIFLIKAA  123

Query  124  GLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            GLSS+D+L  L QRL ++L  EK IVH+QLAAIALLRLSQ ++
Sbjct  124  GLSSEDILKKLHQRLQNNLAIEKVIVHEQLAAIALLRLSQEVQ  166


> B6D1N6 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 
[Klebsiella pneumoniae]
Length=166

 Score =  122 bits (305),  Expect = 3e-38
 Identities = 67/165 (41%), Positives = 96/165 (58%), Gaps = 10/165 (6%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            +  S FN    D+A  +L+ CV IP+W  TL   RP+ SR  L  +A++   NW  ++++
Sbjct  2    IALSQFNSLSKDEAAGLLAPCVAIPAWGETLVSLRPFASRHALLQTAREAMANWGEDELN  61

Query  61   AALATHPRIGEK----KAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGF  116
            AAL+ HPRIGEK    +A   L+ +E+   DSE      ++   QAL EGN  YE +FG+
Sbjct  62   AALSAHPRIGEKPTGCQAHAALSRQEQSSVDSE------NERLAQALREGNARYEARFGW  115

Query  117  IFLIKAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRL  161
            +FLI+A G S ++ML AL +RL H  + E      QL  I +LRL
Sbjct  116  VFLIRAKGRSGEEMLQALTRRLQHTADEEVAEALAQLREITMLRL  160


> A6T925 OHCU_decarbox domain-containing protein [Klebsiella pneumoniae 
subsp. pneumoniae (strain ATCC 700721 / MGH 78578)]
Length=166

 Score =  119 bits (298),  Expect = 3e-37
 Identities = 66/166 (40%), Positives = 93/166 (56%), Gaps = 4/166 (2%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIH  60
            +  S FN    D+A  +L+ CV +P+W  TL   RP+ SR  L  +A++   NW  ++++
Sbjct  2    IALSQFNSLSKDEAAGLLAPCVALPAWGETLVSLRPFASRHALLQTAREAMANWGEDELN  61

Query  61   AALATHPRIGEKKAKQQLTEREEKFSDSEQSGV-KQDQYTQQALLEGNMAYEQKFGFIFL  119
            AAL+ HPRIGEK    Q        S  EQS V  +++   QAL EGN  YE +FG +FL
Sbjct  62   AALSAHPRIGEKPTGSQ---AHAALSRQEQSSVDSENERLAQALREGNARYEARFGRVFL  118

Query  120  IKAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGI  165
            I+A G S +++L AL +RL H  + E      QL  I +LRL   I
Sbjct  119  IRAKGRSGEEILQALTRRLQHTADEEVAEALAQLREITMLRLEGAI  164


> D8V0F4 Cytosolic S-allantoin synthase splice variant 2 [Arabidopsis 
thaliana]
Length=311

 Score = 51.6 bits (122),  Expect = 8e-12
 Identities = 37/139 (27%), Positives = 73/139 (53%), Gaps = 27/139 (19%)

Query  33   QQRPYPSREVLFDSAKQQTQNWSWNDIHAALATHPRIGEKK--------AKQQLTEREEK  84
            Q+  Y +R++ F+    Q     W +   A + HP+IG           A++ ++E+   
Sbjct  32   QEAIYTARDIWFN----QVNVTDWLE---AFSAHPQIGNSPSPSINSDFARRSVSEQSTA  84

Query  85   FSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAAGLSSDDMLNALQQRLNHDLET  144
            F+ +  S +       Q L E N+ Y++KF FIF+I A+G +  +ML+AL++R  +    
Sbjct  85   FATTSASAL-------QELAEWNVLYKKKFSFIFIICASGRTHAEMLHALKERYEN----  133

Query  145  EKNIVHQQLAAIALLRLSQ  163
             + IV  ++AA+  +++++
Sbjct  134  -RPIVELEIAAMEQMKITE  151


> D8V0F3 Peroxisomal S-allantoin synthase splice variant 1 [Arabidopsis 
thaliana]
Length=324

 Score = 51.6 bits (122),  Expect = 8e-12
 Identities = 37/139 (27%), Positives = 73/139 (53%), Gaps = 27/139 (19%)

Query  33   QQRPYPSREVLFDSAKQQTQNWSWNDIHAALATHPRIGEKK--------AKQQLTEREEK  84
            Q+  Y +R++ F+    Q     W +   A + HP+IG           A++ ++E+   
Sbjct  32   QEAIYTARDIWFN----QVNVTDWLE---AFSAHPQIGNSPSPSINSDFARRSVSEQSTA  84

Query  85   FSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAAGLSSDDMLNALQQRLNHDLET  144
            F+ +  S +       Q L E N+ Y++KF FIF+I A+G +  +ML+AL++R  +    
Sbjct  85   FATTSASAL-------QELAEWNVLYKKKFSFIFIICASGRTHAEMLHALKERYEN----  133

Query  145  EKNIVHQQLAAIALLRLSQ  163
             + IV  ++AA+  +++++
Sbjct  134  -RPIVELEIAAMEQMKITE  151


> Q0ZD39 Parahox neighbor [Polypterus senegalus]
Length=113

 Score = 37.4 bits (85),  Expect = 2e-07
 Identities = 31/103 (30%), Positives = 50/103 (49%), Gaps = 8/103 (8%)

Query  63   LATHPRIGEKKAKQ-QLTEREEKFSDSEQSGV---KQDQYTQQALLEGNMAYEQKFGFIF  118
            L  HP +  ++A + QLT   +K    EQ G      D   +  + + N  Y++KFGF F
Sbjct  3    LRCHPDLAGREALRCQLTTESQK----EQRGAGLTSLDSTDKFRIDQLNTEYKEKFGFPF  58

Query  119  LIKAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRL  161
            +I A     D++   L++RL +D   E     +++  I  LRL
Sbjct  59   VICARMSDKDEIFQQLKERLLNDPMAELRTGIEEVKKICHLRL  101



Lambda      K        H        a         alpha
   0.319    0.131    0.386    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 352040


  Database: a661af178d6da41b81b1dbb37e8e5d64.TrEMBL.fasta
    Posted date:  Sep 19, 2020  12:08 PM
  Number of letters in database: 3,430
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40