ACIAD3537 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: e5abf29cc702a9ac0965c8ad934f6fab.SwissProt.fasta
           6 sequences; 2,320 total letters



Query= ACIAD3537

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q54SV3 Probable allantoinase 1 [Dictyostelium discoideum]           62.0    3e-15
  Q45697 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxyl...  55.8    3e-13
  Q9LVM5 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxyl...  53.5    1e-12
  O32141 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxyl...  45.8    6e-10
  D8JBB8 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxyl...  42.0    7e-09
  Q0ZDF7 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxyl...  35.8    1e-06


> Q54SV3 Probable allantoinase 1 [Dictyostelium discoideum]
Length=649

 Score = 62.0 bits (149),  Expect = 3e-15
 Identities = 46/150 (31%), Positives = 72/150 (48%), Gaps = 12/150 (8%)

Query  21   CVHI-----PSWINTLCQQRPYPSREVLFDSAKQQTQNWSWNDIHAALATHPRIGEKKAK  75
            C+H+     P   N L  +RP+ S + L D A    Q+ + +D    +  HPRIG   ++
Sbjct  499  CIHLLFEAAPPLANALFSKRPFSSYQQLIDQAYSIIQSLNESDKIQVINAHPRIGVSASQ  558

Query  76   QQLTEREEKFSDSEQSGVKQ---DQYTQQALLEGNMAYEQKFGFIFLIKAAGLSSDDMLN  132
                +     S  EQS  K    DQ   + L + N  YE KFGF F++   G   ++++ 
Sbjct  559  ---VKNSSSISYREQSCDKDSSIDQSILENLTQLNQQYESKFGFKFVVFVNGRPKNEIIP  615

Query  133  ALQQRL-NHDLETEKNIVHQQLAAIALLRL  161
             LQ RL N+D + E N+   ++  I+  RL
Sbjct  616  ILQNRLNNNDKQKELNLGLSEMIEISKSRL  645


> Q45697 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 
/ Uricase [Bacillus sp. (strain TB-90)]
Length=502

 Score = 55.8 bits (133),  Expect = 3e-13
 Identities = 36/164 (22%), Positives = 75/164 (46%), Gaps = 5/164 (3%)

Query  1    VRFSDFNDAPSDDANAVLSACVHIPSWINTLCQ-QRPYPSREVLFDSAKQQTQNWSWNDI  59
            +R    N+  + +   +L       SW+    +  RPY S + L++   +  +  S N+ 
Sbjct  2    MRLKQLNEMSASEFIHLLGGVFENSSWVAERAEPNRPYSSFQSLYNKMVEIVETASDNEQ  61

Query  60   HAALATHPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFL  119
               +  HP +G        ++ E+K +   +  + +D+     LL  N  Y+ KFGF F+
Sbjct  62   LKLIQMHPHLGTNVKITDFSQEEQKHAGLNE--LTKDEQNHLILL--NQKYKDKFGFPFV  117

Query  120  IKAAGLSSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQ  163
            +   G    ++   +++RL ++ +TE     +++  IA+ RL +
Sbjct  118  MAVRGKIKQEIFRTIKERLQNNHQTEFKQALEEIKKIAMFRLQE  161


 Score = 16.2 bits (30),  Expect = 4.1
 Identities = 8/20 (40%), Positives = 12/20 (60%), Gaps = 5/20 (25%)

Query  40   REVLFDSAKQQTQNWSWNDI  59
            +EV F+S     QN +W+ I
Sbjct  438  QEVYFES-----QNHTWDKI  452


> Q9LVM5 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 
/ 5-hydroxyisourate hydrolase [Arabidopsis thaliana]
Length=324

 Score = 53.5 bits (127),  Expect = 1e-12
 Identities = 38/139 (27%), Positives = 74/139 (53%), Gaps = 27/139 (19%)

Query  33   QQRPYPSREVLFDSAKQQTQNWSWNDIHAALATHPRIGEKK--------AKQQLTEREEK  84
            Q+  Y +R++ F+    Q     W +   A + HP+IG           A++ ++E+   
Sbjct  32   QEAIYTARDIWFN----QVNVTDWLE---AFSAHPQIGNTPSPSINSDFARRSVSEQSTA  84

Query  85   FSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAAGLSSDDMLNALQQRLNHDLET  144
            F+ +  S +       Q L E N+ Y++KFGFIF+I A+G +  +ML+AL++R  +    
Sbjct  85   FATTSASAL-------QELAEWNVLYKKKFGFIFIICASGRTHAEMLHALKERYEN----  133

Query  145  EKNIVHQQLAAIALLRLSQ  163
             + IV  ++AA+  +++++
Sbjct  134  -RPIVELEIAAMEQMKITE  151


> O32141 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 
/ Uricase [Bacillus subtilis (strain 168)]
Length=494

 Score = 45.8 bits (107),  Expect = 6e-10
 Identities = 30/97 (31%), Positives = 50/97 (52%), Gaps = 4/97 (4%)

Query  66   HPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAAGL  125
            HPR+G KK     + RE++  ++    ++Q +Y +  +L  N  Y  +FGF F++   G 
Sbjct  68   HPRLGTKKTMSDDSVREQQ--NAGLGKLEQQEYEEFLML--NEHYYDRFGFPFILAVKGK  123

Query  126  SSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLS  162
            +  D+  AL  RL  + ETE      ++  IA  RL+
Sbjct  124  TKQDIHQALLARLESERETEFQQALIEIYRIARFRLA  160


 Score = 16.2 bits (30),  Expect = 4.1
 Identities = 4/10 (40%), Positives = 8/10 (80%), Gaps = 0/10 (0%)

Query  50   QTQNWSWNDI  59
            Q+QN +W+ +
Sbjct  438  QSQNHTWDTV  447


> D8JBB8 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 
[Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 
/ JCM 14584 / KCTC 4019 / B3)]
Length=176

 Score = 42.0 bits (97),  Expect = 7e-09
 Identities = 34/131 (26%), Positives = 58/131 (44%), Gaps = 6/131 (5%)

Query  34   QRPYPSREVLFDSAKQQTQNWSWNDIHAALATHPRIGEKKAKQQLTEREEKFSDSEQSGV  93
            ++P+ S + L  +     Q+ S       L  HP +GE+   +   E +E+ + +    +
Sbjct  38   EQPFSSIDGLQQAMANTVQDASQQKQLELLRAHPDLGERT--EMTDESQEEQASAGLDRL  95

Query  94   KQDQY-TQQALLEGNMAYEQKFGFIFLIKAAGLSSDDMLNALQQRLNHDLETEKNIVHQQ  152
               QY T Q L   N  Y  KFGF F++     S   +  A++ R++H    E      +
Sbjct  96   PPAQYETFQTL---NDTYRDKFGFPFIMAVKDESVGTIQQAMEDRIDHSRSKEFQTALNE  152

Query  153  LAAIALLRLSQ  163
            +  IA LRL +
Sbjct  153  VNVIAALRLEE  163


> Q0ZDF7 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 
[Amia calva]
Length=175

 Score = 35.8 bits (81),  Expect = 1e-06
 Identities = 23/101 (23%), Positives = 46/101 (46%), Gaps = 0/101 (0%)

Query  66   HPRIGEKKAKQQLTEREEKFSDSEQSGVKQDQYTQQALLEGNMAYEQKFGFIFLIKAAGL  125
            HP +  +  K+     E +   ++      D      +   N  Y+++FGF F+I A   
Sbjct  67   HPDLAGRDLKRGALTAESRGEQTQAGLTLLDAGDAARMNRLNAQYKERFGFPFVICARMN  126

Query  126  SSDDMLNALQQRLNHDLETEKNIVHQQLAAIALLRLSQGIE  166
            + +++L  L +RL ++   E+    +++  I  LRL   I+
Sbjct  127  NKEEILLRLAERLGNEPAQERQCAIEEVKKICQLRLQDIIQ  167



Lambda      K        H        a         alpha
   0.319    0.131    0.386    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 277728


  Database: e5abf29cc702a9ac0965c8ad934f6fab.SwissProt.fasta
    Posted date:  Sep 19, 2020  12:17 PM
  Number of letters in database: 2,320
  Number of sequences in database:  6



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40