ACIAD3577 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 3315eb56dccc3b0236424808fa2aaab1.TrEMBL.fasta
           21 sequences; 8,508 total letters



Query= ACIAD3577

Length=129
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A2S5TPI2 Fumarylacetoacetase [Kaistia algarum]                     144    3e-45
  A0A2W5R616 Fumarylacetoacetase [Acinetobacter johnsonii]             144    1e-44
  A0A2N6V7W2 Fumarylacetoacetase [Acinetobacter ursingii]              144    1e-44
  A0A1R7Q844 Fumarylacetoacetate (FAA) hydrolase family protein [...   144    2e-44
  D0S8A3 Fumarylacetoacetase [Acinetobacter johnsonii SH046]           144    2e-44
  N9BWG3 Fumarylacetoacetase [Acinetobacter ursingii ANC 3649]         144    2e-44
  A0A1T1JQL9 Fumarylacetoacetase [Acinetobacter sp. MF4640]            144    2e-44
  A0A239RZU8 Fumarylacetoacetase [Acinetobacter johnsonii]             143    2e-44
  A0A0U3T4B0 Fumarylacetoacetase [Acinetobacter johnsonii XBB1]        143    2e-44
  A0A1G3DK68 Fumarylacetoacetase [Pseudomonadales bacterium RIFCS...   140    2e-43
  A0A1T1J5S6 Fumarylacetoacetase [Acinetobacter sp. MF4642]            140    2e-43
  N8ZNL2 Fumarylacetoacetase [Acinetobacter gerneri DSM 14967 = C...   137    3e-42
  A0A1P8EKV6 Fumarylacetoacetase [Acinetobacter soli]                  136    9e-42
  N9AK07 Fumarylacetoacetase [Acinetobacter soli NIPH 2899]            135    2e-41
  A0A0M1I862 Fumarylacetoacetase [Acinetobacter sp. C15]               135    2e-41
  A0A2S4T6Y8 Fumarylacetoacetase [Acinetobacter sp. ACNIH4]            134    7e-41
  N9AIP8 Fumarylacetoacetase [Acinetobacter schindleri CIP 107287]     134    7e-41
  A0A1B2G383 Fumarylacetoacetase [Rhodnius prolixus]                  77.4    2e-20
  Q6EMI8 Fumarylacetoacetase [Pseudomonas putida]                     76.3    5e-20
  A5HNY1 Fumarylacetoacetase [Pseudomonas chlororaphis]               51.2    8e-12
  H6TG58 Fumarylpyruvate hydrolase [Paenibacillus sp. NyZ101]         41.2    3e-08


> A0A2S5TPI2 Fumarylacetoacetase [Kaistia algarum]
Length=318

 Score =  144 bits (362),  Expect = 3e-45
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  61   VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  120

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  121  FGMVLFNDWSARDL  134


> A0A2W5R616 Fumarylacetoacetase [Acinetobacter johnsonii]
Length=392

 Score =  144 bits (362),  Expect = 1e-44
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 6e-14
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQARAGVALGEWVV  46


> A0A2N6V7W2 Fumarylacetoacetase [Acinetobacter ursingii]
Length=401

 Score =  144 bits (362),  Expect = 1e-44
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 6e-14
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 2/63 (3%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVMVSGTDIIRPSGQIK  60
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+     ++   G  K
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQPRAGVALGEWVI--DLAVLEAHGYCK  58

Query  61  LPD  63
           + D
Sbjct  59  VAD  61


> A0A1R7Q844 Fumarylacetoacetate (FAA) hydrolase family protein 
[Acinetobacter johnsonii]
Length=427

 Score =  144 bits (362),  Expect = 2e-44
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 7e-14
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 2/63 (3%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVMVSGTDIIRPSGQIK  60
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+     ++   G  K
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQPRAGVALGEWVV--DLAVLEAHGYCK  58

Query  61  LPD  63
           + D
Sbjct  59  VAD  61


> D0S8A3 Fumarylacetoacetase [Acinetobacter johnsonii SH046]
Length=427

 Score =  144 bits (362),  Expect = 2e-44
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 7e-14
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 2/63 (3%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVMVSGTDIIRPSGQIK  60
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+     ++   G  K
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQPRAGVALGEWVI--DLAVLEAHGYCK  58

Query  61  LPD  63
           + D
Sbjct  59  VAD  61


> N9BWG3 Fumarylacetoacetase [Acinetobacter ursingii ANC 3649]
Length=427

 Score =  144 bits (362),  Expect = 2e-44
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 7e-14
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 2/63 (3%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVMVSGTDIIRPSGQIK  60
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+     ++   G  K
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQPRAGVALGEWVI--DLAVLEAHGYCK  58

Query  61  LPD  63
           + D
Sbjct  59  VAD  61


> A0A1T1JQL9 Fumarylacetoacetase [Acinetobacter sp. MF4640]
Length=427

 Score =  144 bits (362),  Expect = 2e-44
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 7e-14
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQARAGVALGEWVV  46


> A0A239RZU8 Fumarylacetoacetase [Acinetobacter johnsonii]
Length=427

 Score =  143 bits (361),  Expect = 2e-44
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERP+FSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPIFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.2 bits (139),  Expect = 9e-14
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQPRAGVALGEWVI  46


> A0A0U3T4B0 Fumarylacetoacetase [Acinetobacter johnsonii XBB1]
Length=427

 Score =  143 bits (361),  Expect = 2e-44
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERP+FSAC KLDFELETGFI+GKSSQ+GQP+PIE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPIFSACRKLDFELETGFIVGKSSQLGQPVPIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.2 bits (139),  Expect = 9e-14
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQPRAGVALGEWVI  46


> A0A1G3DK68 Fumarylacetoacetase [Pseudomonadales bacterium RIFCSPHIGHO2_12_FULL_40_16]
Length=427

 Score =  140 bits (354),  Expect = 2e-43
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+ IE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVQIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 7e-14
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQARAGVALGEWVV  46


> A0A1T1J5S6 Fumarylacetoacetase [Acinetobacter sp. MF4642]
Length=427

 Score =  140 bits (354),  Expect = 2e-43
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIKLPD ERPVFSAC KLDFELETGFI+GKSSQ+GQP+ IE+AWDHI
Sbjct  170  VIVSGTDIVRPSGQIKLPDSERPVFSACRKLDFELETGFIVGKSSQLGQPVSIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 58.5 bits (140),  Expect = 7e-14
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  L SF++++  SDFP++NLPYGIFS   + + R GVALG+WV+
Sbjct  1   MSKRLKSFVEIAAHSDFPLENLPYGIFSEKHNSQARAGVALGEWVV  46


> N8ZNL2 Fumarylacetoacetase [Acinetobacter gerneri DSM 14967 = 
CIP 107464]
Length=427

 Score =  137 bits (346),  Expect = 3e-42
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDI+RPSGQIK+PDQERP+FSAC KLDFELETGFI+GKS+Q+G+P+ IE AWDHI
Sbjct  170  VVVSGTDIVRPSGQIKVPDQERPIFSACRKLDFELETGFIVGKSTQLGEPVAIEDAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARD+
Sbjct  230  FGMVLFNDWSARDI  243


 Score = 68.2 bits (165),  Expect = 3e-17
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 2/61 (3%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVMVSGTDIIRPSGQIK  60
           MT  L+SFI+V   SDFPIQNLP+G+FS + +G RRVGVALG+WV+     ++  +G ++
Sbjct  1   MTMQLTSFIEVKKDSDFPIQNLPFGVFSESPNGTRRVGVALGEWVV--DLSVLEENGLLE  58

Query  61  L  61
           L
Sbjct  59  L  59


> A0A1P8EKV6 Fumarylacetoacetase [Acinetobacter soli]
Length=439

 Score =  136 bits (343),  Expect = 9e-42
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT+I+RPSGQIKLPDQERPVFSAC KLDFELETGFI+GK++ +G+PI IE+AWDHI
Sbjct  170  VVVSGTNIVRPSGQIKLPDQERPVFSACRKLDFELETGFIVGKATHLGEPISIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGVVLFNDWSARDL  243


 Score = 78.6 bits (192),  Expect = 8e-21
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  LSSFI+VSP SDFPIQNLPYGIFS T  GKRRVGVALGDWV+
Sbjct  1   MSVHLSSFIEVSPTSDFPIQNLPYGIFSETTTGKRRVGVALGDWVV  46


> N9AK07 Fumarylacetoacetase [Acinetobacter soli NIPH 2899]
Length=439

 Score =  135 bits (341),  Expect = 2e-41
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT+I+RPSGQIKLPDQERPVFSAC KLDFELETGFI+GK++ +G+PI IE+AWDHI
Sbjct  170  VVVSGTNIVRPSGQIKLPDQERPVFSACRKLDFELETGFIVGKATHLGEPISIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 78.6 bits (192),  Expect = 8e-21
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  LSSFI+VSP SDFPIQNLPYGIFS T  GKRRVGVALGDWV+
Sbjct  1   MSAHLSSFIEVSPTSDFPIQNLPYGIFSETTTGKRRVGVALGDWVV  46


> A0A0M1I862 Fumarylacetoacetase [Acinetobacter sp. C15]
Length=439

 Score =  135 bits (341),  Expect = 2e-41
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT+I+RPSGQIKLPDQERPVFSAC KLDFELETGFI+GK++ +G+PI IE+AWDHI
Sbjct  170  VVVSGTNIVRPSGQIKLPDQERPVFSACRKLDFELETGFIVGKATHLGEPISIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 78.6 bits (192),  Expect = 8e-21
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           M+  LSSFI+VSP SDFPIQNLPYGIFS T  GKRRVGVALGDWV+
Sbjct  1   MSVHLSSFIEVSPTSDFPIQNLPYGIFSETTTGKRRVGVALGDWVV  46


> A0A2S4T6Y8 Fumarylacetoacetase [Acinetobacter sp. ACNIH4]
Length=427

 Score =  134 bits (336),  Expect = 7e-41
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT+I+RPSGQIKLPD +RPVFSAC KLDFELETGFIIGK + +G+PI IE+AWDHI
Sbjct  170  VIVSGTEIVRPSGQIKLPDSDRPVFSACRKLDFELETGFIIGKPNNLGEPIAIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FGIVLFNDWSARDL
Sbjct  230  FGIVLFNDWSARDL  243


 Score = 67.0 bits (162),  Expect = 8e-17
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           MTT L SF+D++P SDFP++NLPYGIFS   + + R GVALG+WV+
Sbjct  1   MTTRLKSFVDIAPDSDFPLENLPYGIFSDKQNAQPRAGVALGEWVV  46


> N9AIP8 Fumarylacetoacetase [Acinetobacter schindleri CIP 107287]
Length=427

 Score =  134 bits (336),  Expect = 7e-41
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT+I+RPSGQIKLPD ERPVFSAC KLDFELETGFIIGK + +G+PI IE+AWDHI
Sbjct  170  VIVSGTEIVRPSGQIKLPDSERPVFSACRKLDFELETGFIIGKPNHLGEPIAIENAWDHI  229

Query  105  FGIVLFNDWSARDL  118
            FG+VLFNDWSARDL
Sbjct  230  FGMVLFNDWSARDL  243


 Score = 66.2 bits (160),  Expect = 2e-16
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)

Query  1   MTTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           MTT L SF+D++P SDFP++NLPYGIFS   + + R G+ALG+WV+
Sbjct  1   MTTRLKSFVDIAPDSDFPLENLPYGIFSDAQNAQPRAGMALGEWVI  46


> A0A1B2G383 Fumarylacetoacetase [Rhodnius prolixus]
Length=413

 Score = 77.4 bits (189),  Expect = 2e-20
 Identities = 39/74 (53%), Positives = 47/74 (64%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT I RP GQ+       P F     LDFELE  F +G  +Q+G  IPI  A +HI
Sbjct  163  VVVSGTPIRRPKGQVCPEGASVPQFKPSVLLDFELEVAFFVGGKTQLGTSIPINKADNHI  222

Query  105  FGIVLFNDWSARDL  118
            FG+VL NDWSARD+
Sbjct  223  FGMVLMNDWSARDI  236


 Score = 52.0 bits (123),  Expect = 1e-11
 Identities = 19/42 (45%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  5   LSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           ++  +D +P  DFP++NLPYG+FST  +  +R+GVA+GD ++
Sbjct  1   MNCVVDYAPDCDFPLENLPYGVFSTNSNPHKRIGVAIGDKIL  42


> Q6EMI8 Fumarylacetoacetase [Pseudomonas putida]
Length=430

 Score = 76.3 bits (186),  Expect = 5e-20
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)

Query  48   SGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHIFGI  107
            SGTD+ RP GQ        P F  C +LD+ELE G  IG+ + +GQ IPI  A +H+ G+
Sbjct  172  SGTDVRRPKGQTLPAGHTEPSFGPCARLDYELELGIWIGQGNDMGQAIPIGDAAEHVAGL  231

Query  108  VLFNDWSARDL  118
             L NDWSARD+
Sbjct  232  CLLNDWSARDI  242


 Score = 38.9 bits (89),  Expect = 2e-07
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query  2   TTSLSSFID-VSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           T +  S+++  +  SDFP+QNLP GIFS      RR GVA+GD ++
Sbjct  4   TANARSWVEHANGHSDFPLQNLPLGIFSRPGEA-RRCGVAIGDAIL  48


> A5HNY1 Fumarylacetoacetase [Pseudomonas chlororaphis]
Length=226

 Score = 51.2 bits (121),  Expect = 8e-12
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)

Query  48   SGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPI  97
            SG ++ RP GQ     Q  P F  C +LD+ELE G  IG+ +++G+PI I
Sbjct  176  SGAEVRRPKGQTLPAGQSEPTFGPCARLDYELELGIWIGQGNEIGEPIAI  225


 Score = 32.3 bits (72),  Expect = 4e-05
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 1/44 (2%)

Query  2   TTSLSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWV  45
           T + S     +  +DFP+QNLP G+FS       R GVA+G+ +
Sbjct  5   TITRSWVASANDHADFPLQNLPLGVFSHK-GAAPRSGVAIGEHI  47


 Score = 16.5 bits (31),  Expect = 7.5
 Identities = 9/26 (35%), Positives = 14/26 (54%), Gaps = 7/26 (27%)

Query  97   IESAWDHIFGIVLFNDWSARDLPMGV  122
            + SA DH        D+  ++LP+GV
Sbjct  11   VASANDHA-------DFPLQNLPLGV  29


> H6TG58 Fumarylpyruvate hydrolase [Paenibacillus sp. NyZ101]
Length=314

 Score = 41.2 bits (95),  Expect = 3e-08
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query  62   PDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHIFGIVLFNDWSARDL  118
            P  + P F    +LD+E E  F+IGK +   + +P + A D++ G  + ND + RDL
Sbjct  139  PQDDIPFFPISEQLDYEAEFAFVIGKRA---RDVPQDQALDYVAGYTIVNDVTYRDL  192


 Score = 18.9 bits (37),  Expect = 1.4
 Identities = 10/28 (36%), Positives = 17/28 (61%), Gaps = 2/28 (7%)

Query  31   VHGKRRVGVA-LGDWVMVSGTDIIRPSG  57
            + GK   G A +G W +V+G ++  P+G
Sbjct  200  LQGKTVEGTAPMGPW-LVTGDELADPTG  226


 Score = 16.9 bits (32),  Expect = 5.8
 Identities = 8/18 (44%), Positives = 10/18 (56%), Gaps = 0/18 (0%)

Query  37   VGVALGDWVMVSGTDIIR  54
            VGVA    V +   DI+R
Sbjct  277  VGVARDPQVFLKDGDIVR  294



Lambda      K        H        a         alpha
   0.327    0.143    0.459    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 663462


  Database: 3315eb56dccc3b0236424808fa2aaab1.TrEMBL.fasta
    Posted date:  Sep 19, 2020  12:29 PM
  Number of letters in database: 8,508
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40