ACIAD3577 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f9a998dbbf213f3435dd056593092863.SwissProt.fasta
           11 sequences; 4,623 total letters



Query= ACIAD3577

Length=129
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A5PKH3 Fumarylacetoacetase [Bos taurus]                             93.2    2e-26
  P16930 Fumarylacetoacetase [Homo sapiens]                           92.4    3e-26
  P35505 Fumarylacetoacetase [Mus musculus]                           88.6    9e-25
  P25093 Fumarylacetoacetase [Rattus norvegicus]                      86.3    6e-24
  Q6H7M1 Fumarylacetoacetase [Oryza sativa subsp. japonica]           85.5    1e-23
  Q1ZXQ1 Fumarylacetoacetase [Dictyostelium discoideum]               85.1    2e-23
  Q8RW90 Fumarylacetoacetase [Arabidopsis thaliana]                   84.3    3e-23
  Q00770 Fumarylacetoacetase [Emericella nidulans (strain FGSC A4...  79.3    2e-21
  O06724 Uncharacterized protein YisK [Bacillus subtilis (strain ...  42.4    7e-09
  Q8R0F8 Acylpyruvase FAHD1, mitochondrial [Mus musculus]             35.0    2e-06
  F2S703 C6 finger domain transcription factor nscR [Trichophyton...  34.7    4e-06


> A5PKH3 Fumarylacetoacetase [Bos taurus]
Length=419

 Score = 93.2 bits (230),  Expect = 2e-26
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT I RP GQ++  D + PV+ AC  LDFELE  F +G  +++G+PIPI  A +HI
Sbjct  166  VVVSGTPIRRPLGQMRPDDSKPPVYGACKLLDFELEMAFFVGPGNKLGEPIPISKAHEHI  225

Query  105  FGIVLFNDWSARDL  118
            FG+VL NDWSARD+
Sbjct  226  FGMVLMNDWSARDI  239


 Score = 52.8 bits (125),  Expect = 3e-12
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)

Query  7   SFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           SF+ V+  SDFPI NLPYG+FST  + + R+GVA+GD ++
Sbjct  2   SFVPVAEDSDFPIHNLPYGVFSTRGNPRPRIGVAIGDQIL  41


> P16930 Fumarylacetoacetase [Homo sapiens]
Length=419

 Score = 92.4 bits (228),  Expect = 3e-26
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT I RP GQ+K  D + PV+ AC  LD ELE  F +G  +++G+PIPI  A +HI
Sbjct  166  VVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHI  225

Query  105  FGIVLFNDWSARDL  118
            FG+VL NDWSARD+
Sbjct  226  FGMVLMNDWSARDI  239


 Score = 52.4 bits (124),  Expect = 4e-12
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)

Query  7   SFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           SFI V+  SDFPI NLPYG+FST    + R+GVA+GD ++
Sbjct  2   SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQIL  41


> P35505 Fumarylacetoacetase [Mus musculus]
Length=419

 Score = 88.6 bits (218),  Expect = 9e-25
 Identities = 39/74 (53%), Positives = 53/74 (72%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            ++VSGT I RP GQ++  + + PV+ AC  LD ELE  F +G  ++ G+PIPI  A +HI
Sbjct  166  IVVSGTPIRRPMGQMRPDNSKPPVYGACRLLDMELEMAFFVGPGNRFGEPIPISKAHEHI  225

Query  105  FGIVLFNDWSARDL  118
            FG+VL NDWSARD+
Sbjct  226  FGMVLMNDWSARDI  239


 Score = 56.6 bits (135),  Expect = 2e-13
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)

Query  7   SFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           SFI V+  SDFPIQNLPYG+FST  + K R+GVA+GD ++
Sbjct  2   SFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQIL  41


> P25093 Fumarylacetoacetase [Rattus norvegicus]
Length=419

 Score = 86.3 bits (212),  Expect = 6e-24
 Identities = 39/74 (53%), Positives = 53/74 (72%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGT I RP GQ++  + + PV+ A  +LD ELE  F +G  ++ G+PIPI  A +HI
Sbjct  166  VVVSGTPIRRPMGQMRPDNSKPPVYGASKRLDMELEMAFFVGPGNRFGEPIPISKAQEHI  225

Query  105  FGIVLFNDWSARDL  118
            FG+VL NDWSARD+
Sbjct  226  FGMVLMNDWSARDI  239


 Score = 56.6 bits (135),  Expect = 2e-13
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)

Query  7   SFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           SFI V+  SDFPIQNLPYG+FST  + K R+GVA+GD ++
Sbjct  2   SFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQIL  41


> Q6H7M1 Fumarylacetoacetase [Oryza sativa subsp. japonica]
Length=429

 Score = 85.5 bits (210),  Expect = 1e-23
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            V+VSGTDIIRP GQ       RP F    KLDFELE   I+G  +++G+PI I  A +HI
Sbjct  179  VIVSGTDIIRPKGQGHPTGDSRPYFGPSKKLDFELEMAAIVGPGNELGKPIDINDAEEHI  238

Query  105  FGIVLFNDWSARDL  118
            FG+++ NDWSARD+
Sbjct  239  FGLMIMNDWSARDI  252


 Score = 40.4 bits (93),  Expect = 4e-08
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 3/45 (7%)

Query  5   LSSFIDVSPQSDFPIQNLPYGIF---STTVHGKRRVGVALGDWVM  46
           L SF++V+P S FPIQNLP+G+F    +      R  VA+GD+ +
Sbjct  9   LRSFVEVAPGSHFPIQNLPFGVFRRRGSPEPEPPRPAVAIGDFAL  53


> Q1ZXQ1 Fumarylacetoacetase [Dictyostelium discoideum]
Length=427

 Score = 85.1 bits (209),  Expect = 2e-23
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 2/76 (3%)

Query  45   VMVSGTDIIRPSGQIKLPDQER-PVFSACHKLDFELETGFIIG-KSSQVGQPIPIESAWD  102
            ++VSGT + RP GQ K  + +  P F+ C  LDFELE G +IG +S+++G+PI IESA D
Sbjct  170  IVVSGTPLKRPWGQTKSDEPDSLPTFNPCRLLDFELEMGALIGGESTKLGEPISIESAKD  229

Query  103  HIFGIVLFNDWSARDL  118
            HIFG+VL NDWSARD+
Sbjct  230  HIFGLVLLNDWSARDI  245


 Score = 57.4 bits (137),  Expect = 9e-14
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)

Query  5   LSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWV  45
           L SFI+VS  S FPIQNLPYG+F  T++ + R+GVA+GD+V
Sbjct  4   LKSFIEVSEDSHFPIQNLPYGVFKPTLNDQARIGVAIGDFV  44


> Q8RW90 Fumarylacetoacetase [Arabidopsis thaliana]
Length=421

 Score = 84.3 bits (207),  Expect = 3e-23
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)

Query  45   VMVSGTDIIRPSGQIKLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAWDHI  104
            +++SGTDIIRP GQ        P F    KLDFELE   ++G  +++G+PI + +A DHI
Sbjct  171  IVISGTDIIRPRGQGHPQGNSEPYFGPSKKLDFELEMAAVVGPGNELGKPIDVNNAADHI  230

Query  105  FGIVLFNDWSARDL  118
            FG++L NDWSARD+
Sbjct  231  FGLLLMNDWSARDI  244


 Score = 48.5 bits (114),  Expect = 8e-11
 Identities = 23/42 (55%), Positives = 27/42 (64%), Gaps = 0/42 (0%)

Query  5   LSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           L SFIDV   S FPIQNLPYG+F    +   R  VA+GD V+
Sbjct  4   LKSFIDVGSDSHFPIQNLPYGVFKPESNSTPRPAVAIGDLVL  45


> Q00770 Fumarylacetoacetase [Emericella nidulans (strain FGSC 
A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)]
Length=431

 Score = 79.3 bits (194),  Expect = 2e-21
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 3/77 (4%)

Query  45   VMVSGTDIIRPSGQI---KLPDQERPVFSACHKLDFELETGFIIGKSSQVGQPIPIESAW  101
            V+ SGT + RP GQI      + + P FS C KLD ELE  F +   + +G P+ I+ A 
Sbjct  173  VVTSGTPLHRPQGQILTNPAANPKLPTFSPCKKLDIELELAFFVSTPNDLGHPVHIDKAE  232

Query  102  DHIFGIVLFNDWSARDL  118
            DHIFG+VL NDWSARD+
Sbjct  233  DHIFGVVLMNDWSARDI  249


 Score = 33.1 bits (74),  Expect = 1e-05
 Identities = 12/42 (29%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  5   LSSFIDVSPQSDFPIQNLPYGIFSTTVHGKRRVGVALGDWVM  46
           ++S++ +   S F + N+P+GI S++    R   +A+GD+ +
Sbjct  1   MASWLQIPKNSPFSLANIPFGIISSSKLSSRVPAIAIGDYAL  42


> O06724 Uncharacterized protein YisK [Bacillus subtilis (strain 
168)]
Length=301

 Score = 42.4 bits (98),  Expect = 7e-09
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 3/45 (7%)

Query  74   KLDFELETGFIIGKSSQVGQPIPIESAWDHIFGIVLFNDWSARDL  118
            +LD+E E   +IGKS   G  I  E A+DH+FG  + ND +ARDL
Sbjct  144  QLDYEGELAVVIGKS---GTRISKEDAYDHVFGYTIVNDITARDL  185


> Q8R0F8 Acylpyruvase FAHD1, mitochondrial [Mus musculus]
Length=227

 Score = 35.0 bits (79),  Expect = 2e-06
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query  72   CHKLDFELETGFIIGKSSQVGQPIPIESAWDHIFGIVLFNDWSARDL  118
            C  L  E+E G ++GK    G+ IP  +A D++ G  L  D +ARD+
Sbjct  68   CRNLHHEVELGVLLGKR---GEAIPEAAAMDYVAGYALCLDMTARDV  111


> F2S703 C6 finger domain transcription factor nscR [Trichophyton 
tonsurans (strain CBS 112818)]
Length=711

 Score = 34.7 bits (78),  Expect = 4e-06
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 4/70 (6%)

Query  38   GVALGDWVMVSGTDIIRPSGQIKLPDQERPVFSACHKLD---FELETGFIIGKSSQVGQP  94
            G  LG+W   + T+++RP   + L   E P+ ++  K+D   F L++  +I    Q+ + 
Sbjct  626  GDLLGNWSWTTATELLRPGEDLALV-TEAPISTSPQKIDPLLFSLDSQLLIAGQEQLVEA  684

Query  95   IPIESAWDHI  104
                +AWD +
Sbjct  685  DQSWAAWDEV  694



Lambda      K        H        a         alpha
   0.327    0.143    0.459    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 382655


  Database: f9a998dbbf213f3435dd056593092863.SwissProt.fasta
    Posted date:  Sep 19, 2020  12:32 PM
  Number of letters in database: 4,623
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40