ACIAD3597 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ba34276e921506060c6818adeb76b641.TrEMBL.fasta
           22 sequences; 8,501 total letters



Query= ACIAD3597

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F6T2 Beta-lactamase [Acinetobacter baylyi (strain ATCC 33305 ...   793    0.0   
  Q0VJU2 Beta-lactamase [Acinetobacter baylyi]                         793    0.0   
  A0A0M1I997 Beta-lactamase [Acinetobacter sp. C15]                    557    0.0   
  A0A1P8EKV7 Class C beta-lactamase [Acinetobacter soli]               557    0.0   
  N9BTM8 Beta-lactamase [Acinetobacter soli NIPH 2899]                 556    0.0   
  V2T650 Beta-lactamase [Acinetobacter gyllenbergii NIPH 230]          517    0.0   
  A0A1B8UCI2 Beta-lactamase [Acinetobacter gyllenbergii]               516    0.0   
  N8XSM0 Beta-lactamase [Acinetobacter sp. CIP 56.2]                   516    0.0   
  N8V0G1 Beta-lactamase [Acinetobacter sp. NIPH 758]                   514    0.0   
  N9A3G5 Beta-lactamase [Acinetobacter venetianus (strain ATCC 31...   514    0.0   
  A0A089PVQ3 Beta-lactamase [bacterium enrichment culture clone c...   369    1e-127
  Q6T2D3 Beta-lactamase [Mycolicibacterium smegmatis]                  363    2e-126
  D6NSM8 Beta-lactamase [Acinetobacter baumannii]                      362    6e-125
  Q7WZ37 Beta-lactamase [Acinetobacter pittii]                         362    6e-125
  A8QIF8 Beta-lactamase [Acinetobacter baumannii]                      360    2e-124
  S5U5P1 Beta-lactamase [Acinetobacter baumannii]                      360    2e-124
  B2MWW4 Beta-lactamase [Acinetobacter baumannii]                      359    5e-124
  Q83V94 Beta-lactamase [Oligella urethralis]                          359    7e-124
  A7XM81 Beta-lactamase [Acinetobacter baumannii]                      358    1e-123
  Q0VTR6 Beta-lactamase [Acinetobacter pittii]                         358    1e-123
  E3VVM6 Beta-lactamase [Acinetobacter baumannii]                      357    3e-123
  Q83V92 Beta-lactamase [Acinetobacter baumannii]                      357    3e-123


> Q6F6T2 Beta-lactamase [Acinetobacter baylyi (strain ATCC 33305 
/ BD413 / ADP1)]
Length=397

 Score =  793 bits (2049),  Expect = 0.0
 Identities = 397/397 (100%), Positives = 397/397 (100%), Gaps = 0/397 (0%)

Query  1    MMKDILGNLDNVPFKIMTGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMA  60
            MMKDILGNLDNVPFKIMTGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMA
Sbjct  1    MMKDILGNLDNVPFKIMTGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMA  60

Query  61   IAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHP  120
            IAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHP
Sbjct  61   IAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHP  120

Query  121  AQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIRE  180
            AQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIRE
Sbjct  121  AQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIRE  180

Query  181  YSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAI  240
            YSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAI
Sbjct  181  YSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAI  240

Query  241  RVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLG  300
            RVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLG
Sbjct  241  RVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLG  300

Query  301  WEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIP  360
            WEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIP
Sbjct  301  WEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIP  360

Query  361  SQKIGLVMLANRNFPNDARVKAAYATLQQILNADIQK  397
            SQKIGLVMLANRNFPNDARVKAAYATLQQILNADIQK
Sbjct  361  SQKIGLVMLANRNFPNDARVKAAYATLQQILNADIQK  397


> Q0VJU2 Beta-lactamase [Acinetobacter baylyi]
Length=397

 Score =  793 bits (2049),  Expect = 0.0
 Identities = 397/397 (100%), Positives = 397/397 (100%), Gaps = 0/397 (0%)

Query  1    MMKDILGNLDNVPFKIMTGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMA  60
            MMKDILGNLDNVPFKIMTGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMA
Sbjct  1    MMKDILGNLDNVPFKIMTGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMA  60

Query  61   IAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHP  120
            IAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHP
Sbjct  61   IAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHP  120

Query  121  AQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIRE  180
            AQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIRE
Sbjct  121  AQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIRE  180

Query  181  YSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAI  240
            YSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAI
Sbjct  181  YSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAI  240

Query  241  RVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLG  300
            RVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLG
Sbjct  241  RVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLG  300

Query  301  WEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIP  360
            WEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIP
Sbjct  301  WEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIP  360

Query  361  SQKIGLVMLANRNFPNDARVKAAYATLQQILNADIQK  397
            SQKIGLVMLANRNFPNDARVKAAYATLQQILNADIQK
Sbjct  361  SQKIGLVMLANRNFPNDARVKAAYATLQQILNADIQK  397


> A0A0M1I997 Beta-lactamase [Acinetobacter sp. C15]
Length=394

 Score =  557 bits (1436),  Expect = 0.0
 Identities = 267/380 (70%), Positives = 320/380 (84%), Gaps = 0/380 (0%)

Query  18   TGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVA  77
            TGC+AGL+SC  VAQ    Q +Q  +D+HF+PL+ QYQI GM++AV+++G+HYY++YGVA
Sbjct  15   TGCMAGLISCTAVAQPLSAQQVQHQIDQHFQPLIDQYQIPGMSVAVTMHGRHYYRHYGVA  74

Query  78   SKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATL  137
            S QT+Q VSE TLFELGSVSKLF ATLTGYAQAQG LKLSDHPAQYFPELK +AVNQATL
Sbjct  75   SVQTQQAVSEQTLFELGSVSKLFTATLTGYAQAQGNLKLSDHPAQYFPELKQSAVNQATL  134

Query  138  LNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAM  197
            LNLGTYTAGGFPLQFPEQ+ +  DM +YFQ WQPKAAP RIREYSNPSIGLMG +TA AM
Sbjct  135  LNLGTYTAGGFPLQFPEQVTSQSDMVKYFQQWQPKAAPDRIREYSNPSIGLMGELTARAM  194

Query  198  KNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSN  257
            K  Y+ L+E  L  ALGM H+YI VP AQM +YAWGY+A QAIRVSPGMFDA+AYG+KS 
Sbjct  195  KAPYTTLMERNLLVALGMRHTYIQVPTAQMPHYAWGYKAKQAIRVSPGMFDAQAYGLKST  254

Query  258  TADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGN  317
            +ADMLKFLDA++NPQ LKP L++A+++TQ+ YF+VG M+QGLGWEQY YPV+L TLLAGN
Sbjct  255  SADMLKFLDAELNPQRLKPALQQAVESTQIAYFKVGPMQQGLGWEQYAYPVALDTLLAGN  314

Query  318  SAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPND  377
            S +MAL  QP   I+ P+ AP Q  LNKTGATNGF+AYVV IPS++IGLVMLANRNFPN+
Sbjct  315  STQMALNAQPAQPIAHPVKAPAQTWLNKTGATNGFAAYVVFIPSEQIGLVMLANRNFPNE  374

Query  378  ARVKAAYATLQQILNADIQK  397
            AR++AAYATL Q++ ++  K
Sbjct  375  ARIRAAYATLTQLIQSNHNK  394


> A0A1P8EKV7 Class C beta-lactamase [Acinetobacter soli]
Length=394

 Score =  557 bits (1436),  Expect = 0.0
 Identities = 268/380 (71%), Positives = 317/380 (83%), Gaps = 0/380 (0%)

Query  18   TGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVA  77
            TGCIAG +SC  VAQ    Q +Q  +D+HF+PL+ QYQI GM++AV+++G+HYY++YGVA
Sbjct  15   TGCIAGFISCTAVAQPLSAQQVQHQIDQHFQPLIDQYQIPGMSVAVTMHGRHYYRHYGVA  74

Query  78   SKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATL  137
            S QT+Q VSE TLFEL SVSKLF ATLTGYAQAQG LKLSDHPAQYFPELK +AVNQATL
Sbjct  75   SVQTQQAVSEQTLFELASVSKLFTATLTGYAQAQGNLKLSDHPAQYFPELKQSAVNQATL  134

Query  138  LNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAM  197
            LNLGTYTAGGFPLQFPEQ+ T  DM +YFQ WQPKAAP RIREYSNPSIGLMG +TA AM
Sbjct  135  LNLGTYTAGGFPLQFPEQVTTQSDMVKYFQQWQPKAAPDRIREYSNPSIGLMGELTARAM  194

Query  198  KNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSN  257
            K  Y+ L+E  L  ALGM H+YI VP AQM +YAWGY+A QAIRVSPGMFDA+AYG+KS 
Sbjct  195  KAPYTTLMERNLLVALGMRHTYIQVPTAQMPHYAWGYKAKQAIRVSPGMFDAQAYGLKST  254

Query  258  TADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGN  317
            TADMLKFLDA++NPQ LKP L++A++ TQ+ YF+VG M+QGLGWEQY YPV+L TLLAGN
Sbjct  255  TADMLKFLDAELNPQRLKPALQQAVENTQIAYFKVGPMQQGLGWEQYAYPVALDTLLAGN  314

Query  318  SAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPND  377
            S +MAL  QP   I+ P+ AP Q  LNKTGATNGF+AYVV IPS++IGLVMLANRNFPN+
Sbjct  315  STQMALNAQPAQPIAHPVKAPAQTWLNKTGATNGFAAYVVFIPSEQIGLVMLANRNFPNE  374

Query  378  ARVKAAYATLQQILNADIQK  397
            AR++AAYATL Q++ ++  K
Sbjct  375  ARIRAAYATLTQLIQSNHNK  394


> N9BTM8 Beta-lactamase [Acinetobacter soli NIPH 2899]
Length=394

 Score =  556 bits (1433),  Expect = 0.0
 Identities = 266/380 (70%), Positives = 318/380 (84%), Gaps = 0/380 (0%)

Query  18   TGCIAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVA  77
            TGC+ GL+SC  VAQ    Q +Q  +D+HF+PL+ QYQI GM++AV+++G+HYY++YGV 
Sbjct  15   TGCMVGLISCTAVAQPLSAQQVQHQIDQHFQPLIDQYQIPGMSVAVTMHGRHYYRHYGVV  74

Query  78   SKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATL  137
            S +T+Q VSE TLFELGSVSKLF ATLTGYAQAQG LKLSDHPAQYFPELK +AVNQATL
Sbjct  75   SVETQQAVSEQTLFELGSVSKLFTATLTGYAQAQGNLKLSDHPAQYFPELKQSAVNQATL  134

Query  138  LNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAM  197
            LNLGTYTAGGFPLQFPEQ+ T  DM +YFQ WQPKAAP RIREYSNPSIGLMG +TA AM
Sbjct  135  LNLGTYTAGGFPLQFPEQVTTQSDMVKYFQQWQPKAAPDRIREYSNPSIGLMGELTARAM  194

Query  198  KNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSN  257
            K  Y+ L+E  L  ALGM H+YI VP AQM +YAWGY+A QAIRVSPGMFDA+AYG+KS 
Sbjct  195  KAPYTTLMERNLLVALGMRHTYIQVPTAQMPHYAWGYKAKQAIRVSPGMFDAQAYGLKST  254

Query  258  TADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGN  317
            TADMLKFLDA++NPQ LKP L++A+++TQ+ YF+VG M+QGLGWEQY YPV+L TLLAGN
Sbjct  255  TADMLKFLDAELNPQRLKPALQQAVESTQIAYFKVGPMQQGLGWEQYAYPVALDTLLAGN  314

Query  318  SAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPND  377
            S +MAL  QP   I+ P+ AP Q  LNKTGATNGF+AYVV IPS++IGLVMLANRNFPN+
Sbjct  315  STQMALNAQPAQPIAHPVKAPAQTWLNKTGATNGFAAYVVFIPSEQIGLVMLANRNFPNE  374

Query  378  ARVKAAYATLQQILNADIQK  397
            AR++AAYATL Q++ ++  K
Sbjct  375  ARIRAAYATLTQLIQSNHNK  394


> V2T650 Beta-lactamase [Acinetobacter gyllenbergii NIPH 230]
Length=395

 Score =  517 bits (1332),  Expect = 0.0
 Identities = 251/373 (67%), Positives = 298/373 (80%), Gaps = 2/373 (1%)

Query  21   IAGLLSCGTV--AQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVAS  78
            +AGLLSC +   A +  +Q ++  VD+ FKPL+AQY+I GMA+AV++NGQHY+ NYG+AS
Sbjct  17   LAGLLSCSSALWAGNLTEQQVKSIVDQQFKPLLAQYKIPGMAVAVTLNGQHYFVNYGLAS  76

Query  79   KQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLL  138
            KQ +Q VS +TLFELGSVSK FNATLTGYAQAQGQL LSDHPA+YFPELK+TAVN+AT+L
Sbjct  77   KQNQQAVSNNTLFELGSVSKTFNATLTGYAQAQGQLSLSDHPAKYFPELKHTAVNRATIL  136

Query  139  NLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMK  198
            NLG Y AGGFPLQFP+++   QDM +YFQ WQ K      R+YSNPSIGLMGYVTALAMK
Sbjct  137  NLGAYNAGGFPLQFPDEVVQQQDMIKYFQTWQAKTKVGAARQYSNPSIGLMGYVTALAMK  196

Query  199  NSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNT  258
              YS LIE TL P LGM  S+I VP   MS YAWGY+ADQA+RVSPGMFDAEAYG+KS++
Sbjct  197  KPYSELIEKTLLPQLGMTQSFIRVPEQHMSQYAWGYKADQAMRVSPGMFDAEAYGLKSSS  256

Query  259  ADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNS  318
            ADMLKFLDAQINPQ  K  LRKAI+ T +GYF+VG M QGLGWEQY YP+SL TLL GNS
Sbjct  257  ADMLKFLDAQINPQQFKQPLRKAIENTHVGYFKVGAMTQGLGWEQYAYPISLETLLQGNS  316

Query  319  AKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDA  378
            +KMAL+   +T I +P  AP +   NKTGATNGF AYV  IP QKIG+VMLAN NFPN+ 
Sbjct  317  SKMALESHAITPIKQPKLAPPETFFNKTGATNGFGAYVAFIPQQKIGIVMLANTNFPNEE  376

Query  379  RVKAAYATLQQIL  391
            R+KA+Y  +QQ++
Sbjct  377  RIKASYRVMQQLV  389


> A0A1B8UCI2 Beta-lactamase [Acinetobacter gyllenbergii]
Length=395

 Score =  516 bits (1329),  Expect = 0.0
 Identities = 251/373 (67%), Positives = 297/373 (80%), Gaps = 2/373 (1%)

Query  21   IAGLLSCGTV--AQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVAS  78
            + GLLSC +   A +  +Q ++  VD+ FKPL+AQY+I GMA+AV++NGQHY+ NYG+AS
Sbjct  17   LTGLLSCSSALWAGNLTEQQVKTIVDQQFKPLLAQYKIPGMAVAVTLNGQHYFVNYGLAS  76

Query  79   KQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLL  138
            KQ +Q VS +TLFELGSVSK FNATLTGYAQAQGQL LSDHPA+YFPELK+TAVN+AT+L
Sbjct  77   KQNQQAVSNNTLFELGSVSKTFNATLTGYAQAQGQLSLSDHPAKYFPELKHTAVNRATIL  136

Query  139  NLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMK  198
            NLGTY AGGFPLQFP+++   QDM +YFQ WQ K      R+YSNPSIGLMGYVTALAMK
Sbjct  137  NLGTYNAGGFPLQFPDEVVQQQDMIKYFQTWQAKTKVGAARQYSNPSIGLMGYVTALAMK  196

Query  199  NSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNT  258
              YS LIE TL P LGM  S+I VP   MS YAWGY+ADQA+RVSPGMFDAEAYG+KS++
Sbjct  197  KPYSELIEKTLLPQLGMTQSFIRVPEQHMSQYAWGYKADQAMRVSPGMFDAEAYGLKSSS  256

Query  259  ADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNS  318
            ADMLKFLDAQINP+  K  LRKAI+ T +GYF+VG M QGLGWEQY YPVSL TLL GNS
Sbjct  257  ADMLKFLDAQINPRQFKQPLRKAIENTHVGYFKVGAMTQGLGWEQYAYPVSLETLLQGNS  316

Query  319  AKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDA  378
            +KMAL+   +T I +P  AP +   NKTGATNGF AYV  IP QKIG+VMLAN NFPN  
Sbjct  317  SKMALESHAITAIKQPKLAPPETFFNKTGATNGFGAYVAFIPQQKIGIVMLANTNFPNQE  376

Query  379  RVKAAYATLQQIL  391
            R+KA+Y  +QQ++
Sbjct  377  RIKASYRVMQQLV  389


> N8XSM0 Beta-lactamase [Acinetobacter sp. CIP 56.2]
Length=395

 Score =  516 bits (1328),  Expect = 0.0
 Identities = 252/373 (68%), Positives = 294/373 (79%), Gaps = 2/373 (1%)

Query  21   IAGLLSCGTV--AQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVAS  78
            + GLLSC +   A +  +Q +Q  VD+ FKPL+AQY+I GMA+AV++NGQHY+ NYG+AS
Sbjct  17   LTGLLSCSSALWAGNLTEQQVQTIVDQQFKPLLAQYKIPGMAVAVTLNGQHYFVNYGLAS  76

Query  79   KQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLL  138
            KQ +Q VS  TLFELGSVSK FNATL  YAQAQGQL LSDHPA+YFPELKNTAVN+AT+L
Sbjct  77   KQNQQAVSNSTLFELGSVSKTFNATLAAYAQAQGQLSLSDHPAKYFPELKNTAVNRATIL  136

Query  139  NLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMK  198
            NLGTY AGGFPLQFP+++   QDM +YFQ WQPK      R+YSNPSIGLMGYVTALAMK
Sbjct  137  NLGTYNAGGFPLQFPDEVVQQQDMIKYFQAWQPKTTIGAARQYSNPSIGLMGYVTALAMK  196

Query  199  NSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNT  258
              YS LIE TL P LGM  S+I VP   MS YAWGY+ADQA+RVSPGMFDAEAYG+KS++
Sbjct  197  KPYSELIEKTLLPQLGMTQSFIRVPEQHMSQYAWGYKADQAMRVSPGMFDAEAYGLKSSS  256

Query  259  ADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNS  318
            ADMLKFLDAQINPQ  K  LR+AI+ T MGYF+VG M QGLGWEQY YPVSL TLL GNS
Sbjct  257  ADMLKFLDAQINPQQFKQPLRQAIENTHMGYFKVGAMTQGLGWEQYAYPVSLETLLQGNS  316

Query  319  AKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDA  378
            +KMAL+   +T I +P  A      NKTGATNGF AYV  IP QKIG+VMLAN NFPN+ 
Sbjct  317  SKMALESHAITAIKQPKLATPATFFNKTGATNGFGAYVAFIPQQKIGIVMLANTNFPNEE  376

Query  379  RVKAAYATLQQIL  391
            R+KA+Y  +QQ++
Sbjct  377  RIKASYRVMQQLV  389


> N8V0G1 Beta-lactamase [Acinetobacter sp. NIPH 758]
Length=395

 Score =  514 bits (1324),  Expect = 0.0
 Identities = 247/373 (66%), Positives = 296/373 (79%), Gaps = 2/373 (1%)

Query  21   IAGLLSCGTV--AQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVAS  78
            +AGLLSC     AQ   +Q ++  VD+ FKPL+ QY+I GMA+ +++NGQHY+ NYGVAS
Sbjct  17   LAGLLSCSAPLWAQQLSEQQVKAIVDQQFKPLLQQYKIPGMAVGITLNGQHYFVNYGVAS  76

Query  79   KQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLL  138
            KQ++Q +  +TLFELGSVSK FNATL GYAQAQG+L LSDHPA+YFPELKN+AVN+ATLL
Sbjct  77   KQSQQPIRNNTLFELGSVSKTFNATLAGYAQAQGRLSLSDHPAKYFPELKNSAVNRATLL  136

Query  139  NLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMK  198
            NLGTYTAGGFPLQFP+++   Q+M +YFQ WQPK      R+YSNPSIGLMGYVTALAMK
Sbjct  137  NLGTYTAGGFPLQFPDEVVQQQEMIKYFQAWQPKTTIGAARQYSNPSIGLMGYVTALAMK  196

Query  199  NSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNT  258
              Y+ L+E TLFP LG+  S+I VP  QM NYAWGY+ADQA+RVSPGMFDAEAYG+KS++
Sbjct  197  KPYTELLEKTLFPQLGLKQSFIQVPELQMPNYAWGYKADQAMRVSPGMFDAEAYGVKSSS  256

Query  259  ADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNS  318
            ADMLKFLDAQINPQ LK  LRK I+ T +GYF+VG M QGLGWEQY YP  L TLL GNS
Sbjct  257  ADMLKFLDAQINPQQLKQPLRKGIENTHVGYFKVGAMTQGLGWEQYAYPTKLETLLQGNS  316

Query  319  AKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDA  378
            +KMAL+   VT I++P  AP     NKTGATNGF AY   IP QKIG+VMLAN NFPN+ 
Sbjct  317  SKMALESHAVTSIAQPKIAPAATFFNKTGATNGFGAYAAFIPQQKIGIVMLANTNFPNEE  376

Query  379  RVKAAYATLQQIL  391
            R+KA+Y  +QQ++
Sbjct  377  RIKASYNVIQQLI  389


> N9A3G5 Beta-lactamase [Acinetobacter venetianus (strain ATCC 
31012 / CIP 110063 / RAG-1)]
Length=392

 Score =  514 bits (1323),  Expect = 0.0
 Identities = 248/373 (66%), Positives = 298/373 (80%), Gaps = 2/373 (1%)

Query  21   IAGLLSCGTV--AQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVAS  78
            +AG+ S  +   A+   +Q ++  +D+ FKPL+AQY I G+A+AV++NGQHY+ NYGVAS
Sbjct  17   VAGVFSVSSTLWAKDLTEQQVKAVIDQQFKPLLAQYNIPGLAVAVTLNGQHYFVNYGVAS  76

Query  79   KQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLL  138
            KQ++Q V   TLFELGSVSK FNATL GYAQAQG+L  SDHPA+YFPEL NTAVN+AT+L
Sbjct  77   KQSQQPVRNDTLFELGSVSKTFNATLAGYAQAQGKLSFSDHPAKYFPELNNTAVNRATIL  136

Query  139  NLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMK  198
            NLGTYTAGGFPLQFP+++ T QDM +YFQ WQPK      R+YSNPSIGLMGYVTALAMK
Sbjct  137  NLGTYTAGGFPLQFPDEVVTQQDMVKYFQKWQPKTKISVARQYSNPSIGLMGYVTALAMK  196

Query  199  NSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNT  258
              YS LIE TLFP LG+  S+I+VP +QM NYAWGY+ DQA+RVS GMFDAEAYG+KS++
Sbjct  197  KPYSELIEKTLFPELGLKQSFIHVPESQMKNYAWGYKNDQAMRVSAGMFDAEAYGVKSSS  256

Query  259  ADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNS  318
            ADMLKF+DAQ+NPQ LK  +RK I+ T +GYF+VG M QGLGWEQYTYPVSL TLL GNS
Sbjct  257  ADMLKFIDAQLNPQQLKQPMRKTIENTHVGYFKVGAMTQGLGWEQYTYPVSLATLLQGNS  316

Query  319  AKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDA  378
            +KMAL+   VT I +P  A    L NKTGATNGF AYV  IP QKIG+VMLAN NFPN+A
Sbjct  317  SKMALESHTVTPIKQPKLASAATLFNKTGATNGFGAYVAFIPQQKIGIVMLANTNFPNEA  376

Query  379  RVKAAYATLQQIL  391
            R+ A+Y T+QQ+L
Sbjct  377  RITASYQTIQQLL  389


> A0A089PVQ3 Beta-lactamase [bacterium enrichment culture clone 
cep-05]
Length=390

 Score =  369 bits (947),  Expect = 1e-127
 Identities = 180/374 (48%), Positives = 259/374 (69%), Gaps = 5/374 (1%)

Query  18   TGCIAGLLSCGTVAQSTVQQS---IQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNY  74
            TG  A  LS    A +    +   ++  VD+  +P++A+Y + G+A+AV+++G+  + NY
Sbjct  9    TGLTAAALSLFLAAPAQAADANAPLRAIVDQAVRPVIAEYDLPGVAVAVTVDGKASFFNY  68

Query  75   GVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQ  134
            G+AS++ +  VSE+TLFELGS+SK F ATL  YAQ  G+L L DHP +Y PELK +A+++
Sbjct  69   GLASREYQTPVSENTLFELGSISKTFTATLASYAQVTGKLSLEDHPGKYMPELKGSAIDK  128

Query  135  ATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTA  194
            A++LNLGTYTAGG PLQFP+ + +   M  YF+ W+  AAP   R YSNPS+GL G+V A
Sbjct  129  ASVLNLGTYTAGGLPLQFPDDV-SDDGMLAYFKQWKADAAPGTQRRYSNPSLGLFGHVAA  187

Query  195  LAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYG  253
            L+M + ++  +E  + P LGM H+++ VPA  M +YAWGY +A++  RV+PG   AE YG
Sbjct  188  LSMGSGFAEAMEGRILPGLGMKHTHVRVPAGAMGDYAWGYDEANRPGRVNPGPLAAETYG  247

Query  254  IKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTL  313
            I+S+ ADM+++L A I+P  L+  LR+A++ T +GYF++  M QGLGWEQY YPV+L  L
Sbjct  248  IRSSAADMIRYLQANIDPSRLEAPLRRAVEGTHVGYFKIDGMVQGLGWEQYPYPVALAQL  307

Query  314  LAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRN  373
             AGNS KM  +  P + ++ P T P   L NKTG+T+ F AY   +P+QKIG+V+LAN+N
Sbjct  308  EAGNSQKMIREANPASALTPPQTPPPATLFNKTGSTSRFGAYAAFVPAQKIGVVILANKN  367

Query  374  FPNDARVKAAYATL  387
            +P  ARVKAA+  L
Sbjct  368  YPIAARVKAAHEIL  381


> Q6T2D3 Beta-lactamase [Mycolicibacterium smegmatis]
Length=333

 Score =  363 bits (933),  Expect = 2e-126
 Identities = 171/333 (51%), Positives = 241/333 (72%), Gaps = 3/333 (1%)

Query  59   MAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSD  118
            MA+AV+++G+ ++  +GV SKQT+  V+  TLFE+GSVSK F ATL GYA  +G L L D
Sbjct  1    MAVAVTVDGRQHFYEFGVVSKQTQAPVTRDTLFEIGSVSKTFTATLAGYAATRGVLNLDD  60

Query  119  HPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRI  178
            HP +Y P L  T +++A L NLGTYTAGG PLQFPE +   + M  YFQ +QP  AP +I
Sbjct  61   HPGRYLPALAGTPIDRAELRNLGTYTAGGLPLQFPESVTDDEQMIAYFQQFQPVTAPGKI  120

Query  179  REYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGY-QAD  237
            R+YSNPS+GL+G+++A A+   +++L+++ +   LG+  S+++V    M  YAWGY + +
Sbjct  121  RQYSNPSVGLLGHISARALGGQFTDLMQSQILTGLGLRRSFVDVTDEAMDFYAWGYDKKN  180

Query  238  QAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQ  297
              +RV+PG+FDAEAYG+KS TADM++F++  I+P  L+PTLR+A+++TQ+GY++VG M Q
Sbjct  181  HPVRVNPGVFDAEAYGVKSTTADMIRFIEHNIDPGALEPTLREAVKSTQVGYYKVGPMVQ  240

Query  298  GLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVV  357
             LGWEQY YPV+L  LLAGNS +MA+ PQ  T I+ P      AL NKTG+T+GF AY  
Sbjct  241  DLGWEQYPYPVALDQLLAGNSGEMAMSPQAATAIAPPSVG--SALFNKTGSTDGFGAYAA  298

Query  358  VIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
             +P ++IG+VMLAN+NFP  ARV AA+  L  +
Sbjct  299  FVPERRIGIVMLANKNFPIPARVTAAHTVLDAL  331


> D6NSM8 Beta-lactamase [Acinetobacter baumannii]
Length=383

 Score =  362 bits (928),  Expect = 6e-125
 Identities = 175/355 (49%), Positives = 240/355 (68%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNRSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            +T Q +  +F+ WQPK      R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  QTDQQVLTFFKDWQPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F+ A +NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G+++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  ADIQRAINETHQGFYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLDAI  381


> Q7WZ37 Beta-lactamase [Acinetobacter pittii]
Length=383

 Score =  362 bits (928),  Expect = 6e-125
 Identities = 175/355 (49%), Positives = 240/355 (68%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            +T Q +  +F+ WQPK      R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  QTDQQVLTFFKDWQPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F+ A + PQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLTPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G+++VG M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  TDIQRAINETHQGFYQVGTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAI  381


> A8QIF8 Beta-lactamase [Acinetobacter baumannii]
Length=383

 Score =  360 bits (925),  Expect = 2e-124
 Identities = 175/355 (49%), Positives = 240/355 (68%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            KT Q +  +F+ W+PK +    R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  KTDQQVLTFFKDWKPKNSIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F+ A +NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G ++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  ADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAI  381


> S5U5P1 Beta-lactamase [Acinetobacter baumannii]
Length=383

 Score =  360 bits (924),  Expect = 2e-124
 Identities = 174/361 (48%), Positives = 244/361 (68%), Gaps = 4/361 (1%)

Query  31   AQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTL  90
            A +   Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+
Sbjct  24   ANTPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTI  83

Query  91   FELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPL  150
            FELGSVSKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   L
Sbjct  84   FELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLAL  143

Query  151  QFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLF  210
            QFP+++KT Q +  +F+ W+PK +    R+YSNPSIGL G V AL+M   +  ++E T+F
Sbjct  144  QFPDEVKTDQQVLTFFKDWKPKNSIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIF  203

Query  211  PALGMHHSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQI  269
            P LG+ +SY+NVP  Q+ NYA+GY Q +Q IRV+PG  DA AYG+KS   DMLKF++A +
Sbjct  204  PELGLKYSYVNVPKTQIQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLKFINANL  263

Query  270  NPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVT  329
            NPQ     +++AI  T  G+++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT
Sbjct  264  NPQKYPADIQRAINETHQGFYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVT  323

Query  330  GISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQ  389
             ISK    P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R+KAAYA L  
Sbjct  324  AISK---EPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNA  380

Query  390  I  390
            I
Sbjct  381  I  381


> B2MWW4 Beta-lactamase [Acinetobacter baumannii]
Length=383

 Score =  359 bits (922),  Expect = 5e-124
 Identities = 174/355 (49%), Positives = 239/355 (67%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNRSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            +T Q +  +F+ WQPK      R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  QTDQQVLTFFKDWQPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F+ A +NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G+++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  ADIQRAINETHQGFYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+T GF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTTGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAI  381


> Q83V94 Beta-lactamase [Oligella urethralis]
Length=383

 Score =  359 bits (921),  Expect = 7e-124
 Identities = 174/355 (49%), Positives = 240/355 (68%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            +T Q +  +F+ W+PK      R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  QTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F++A +NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFINANLNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G ++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  TDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAI  381


> A7XM81 Beta-lactamase [Acinetobacter baumannii]
Length=383

 Score =  358 bits (919),  Expect = 1e-123
 Identities = 174/355 (49%), Positives = 239/355 (67%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            KT Q +  +F+ W+PK +    R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  KTDQQVLTFFKDWKPKNSIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F+ A +NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G ++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  ADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+T GF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTTGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAI  381


> Q0VTR6 Beta-lactamase [Acinetobacter pittii]
Length=383

 Score =  358 bits (919),  Expect = 1e-123
 Identities = 174/355 (49%), Positives = 238/355 (67%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEIYYGLQSVQDKKAVNSSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G +   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKTKGTISFKDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            +T Q +  +F+ W+PK      R+YSNPSIGL G V AL+M   +  ++E T+FP L + 
Sbjct  150  QTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPGLSLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DMLKF++A +NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLKFINANLNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G+++VG M Q LGWE+++YP  L TLL  NS ++ ++P  VT ISK  
Sbjct  270  ADIQRAINETHQGFYQVGTMYQALGWEEFSYPAPLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R KAAYA L  I
Sbjct  328  -EPSVKMFHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERFKAAYAVLNAI  381


> E3VVM6 Beta-lactamase [Acinetobacter baumannii]
Length=383

 Score =  357 bits (917),  Expect = 3e-123
 Identities = 174/355 (49%), Positives = 238/355 (67%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            +T Q +  +F+ W+PK      R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  QTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F+ A  NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANFNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G ++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  ADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAI  381


> Q83V92 Beta-lactamase [Acinetobacter baumannii]
Length=383

 Score =  357 bits (917),  Expect = 3e-123
 Identities = 174/355 (49%), Positives = 239/355 (67%), Gaps = 4/355 (1%)

Query  37   QSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSV  96
            Q I++ VD++FKPL+ +Y + GMA+ V  N + Y   YG+ S Q ++ V+  T+FELGSV
Sbjct  30   QEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSV  89

Query  97   SKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQI  156
            SKLF AT  GYA+ +G++   D P +Y+ ELKNT ++Q  LL L TYT+G   LQFP+++
Sbjct  90   SKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEV  149

Query  157  KTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMH  216
            +T Q +  +F+ W+PK      R+YSNPSIGL G V AL+M   +  ++E T+FPALG+ 
Sbjct  150  QTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLK  209

Query  217  HSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLK  275
            HSY+NVP  QM NYA+GY Q +Q IRV+PG  DA AYG+KS   DML F+ A +NPQ   
Sbjct  210  HSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIYANLNPQKYP  269

Query  276  PTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPI  335
              +++AI  T  G ++V  M Q LGWE+++YP +L TLL  NS ++ ++P  VT ISK  
Sbjct  270  ADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK--  327

Query  336  TAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
              P   + +KTG+TNGF  YVV IP + IGLVML N+  PN+ R+KAAYA L  I
Sbjct  328  -EPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLSAI  381



Lambda      K        H        a         alpha
   0.319    0.131    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2545522


  Database: ba34276e921506060c6818adeb76b641.TrEMBL.fasta
    Posted date:  Oct 19, 2020  5:55 PM
  Number of letters in database: 8,501
  Number of sequences in database:  22



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40