ACIAD3597 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ac296478def27596b6a4a5a1918ddc87.SwissProt.fasta
           10 sequences; 3,823 total letters



Query= ACIAD3597

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P85302 Beta-lactamase [Pseudomonas fluorescens]                      366    2e-127
  P24735 Beta-lactamase [Pseudomonas aeruginosa (strain ATCC 1569...   342    3e-117
  O05465 Beta-lactamase [Psychrobacter immobilis]                      335    8e-115
  Q48743 Beta-lactamase [Lysobacter lactamgenus]                       321    2e-109
  P00811 Beta-lactamase [Escherichia coli (strain K12)]                317    6e-108
  P45460 Beta-lactamase [Yersinia enterocolitica]                      299    9e-101
  P18539 Beta-lactamase [Serratia marcescens]                          298    2e-100
  P05364 Beta-lactamase [Enterobacter cloacae]                         295    2e-99 
  P05193 Beta-lactamase [Citrobacter freundii]                         293    1e-98 
  P94958 Beta-lactamase [Morganella morganii]                          292    2e-98 


> P85302 Beta-lactamase [Pseudomonas fluorescens]
Length=358

 Score =  366 bits (940),  Expect = 2e-127
 Identities = 178/350 (51%), Positives = 246/350 (70%), Gaps = 1/350 (0%)

Query  39   IQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSK  98
            I+Q VD   +PLM Q  I+G+++AV  NG+  Y NYGVA+K ++Q ++E+TLFE+GSVSK
Sbjct  4    IRQVVDSTVEPLMQQQDIAGLSVAVIQNGKAQYFNYGVANKDSKQPITENTLFEIGSVSK  63

Query  99   LFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKT  158
             F ATL GYA A G+LKLSD  +QY P L+    +  +LLNLGTYTAGG PLQFPE+   
Sbjct  64   TFTATLAGYALANGKLKLSDPASQYLPALRGDKFDHISLLNLGTYTAGGLPLQFPEESDN  123

Query  159  TQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHS  218
            T  M  Y+QHW+P  AP   R YSNPSIGL G++ A ++   +  L+E T+ P LG+ H+
Sbjct  124  TGKMISYYQHWKPAFAPGTQRLYSNPSIGLFGHLAAQSLGQPFEKLMEQTVLPKLGLKHT  183

Query  219  YINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNLKPT  277
            +I+VP  QMS YA GY +A + +RVSPG  DAEAYGIK++T+D++ +++  ++P  L+  
Sbjct  184  FISVPETQMSLYAQGYDKAGKPVRVSPGALDAEAYGIKTSTSDLIHYVEVNMHPAKLEKP  243

Query  278  LRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITA  337
            L++AI  T  GY+ V  M QGLGWE Y YP+ +  L+ GNS +MA++P  V  ++ P  A
Sbjct  244  LQQAIAATHTGYYTVDGMTQGLGWEMYPYPIKVDALVEGNSTQMAMEPHKVNWLTPPQAA  303

Query  338  PQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATL  387
            P   L+NKTG+T GF AYV  +PS+ +G+V+LAN+N+PN  RVKAA+A L
Sbjct  304  PLDTLVNKTGSTGGFGAYVAYVPSKGLGVVILANKNYPNAERVKAAHAIL  353


> P24735 Beta-lactamase [Pseudomonas aeruginosa (strain ATCC 15692 
/ DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / 
PRS 101 / PAO1)]
Length=397

 Score =  342 bits (876),  Expect = 3e-117
 Identities = 171/379 (45%), Positives = 245/379 (65%), Gaps = 5/379 (1%)

Query  14   FKIMTGCIAGLLSCGT---VAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHY  70
            F  + G  A  L   T   +A       ++  VD   +P+M    I G+A+A+S+ G+ +
Sbjct  6    FPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPH  65

Query  71   YQNYGVASKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNT  130
            Y +YG+ASK+  + V+  TLFE+GSVSK F ATL GYA  Q +++L D  +Q++P L+ +
Sbjct  66   YFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGS  125

Query  131  AVNQATLLNLGTYTAGGFPLQFPEQIKTTQ-DMTQYFQHWQPKAAPRRIREYSNPSIGLM  189
              +  +LL+L TYTAGG PLQFP+ ++  Q  +  Y++ WQP  AP   R YSNPSIGL 
Sbjct  126  RFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLF  185

Query  190  GYVTALAMKNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGY-QADQAIRVSPGMFD  248
            GY+ A ++   +  L+E  +FPALG+  ++++VP A ++ YA GY + D+ +RV PG  D
Sbjct  186  GYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLD  245

Query  249  AEAYGIKSNTADMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPV  308
            AE YG+K++ AD+L+F+DA ++P+ L     +A+  T  GY++VG M QGLGWE Y +P+
Sbjct  246  AEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPI  305

Query  309  SLTTLLAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVM  368
            SL  L AGNS  MALQP  +  +  P     Q LLNKTG+TNGF AYV  +P + +GLV+
Sbjct  306  SLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVI  365

Query  369  LANRNFPNDARVKAAYATL  387
            LANRN+PN  RVK AYA L
Sbjct  366  LANRNYPNAERVKIAYAIL  384


> O05465 Beta-lactamase [Psychrobacter immobilis]
Length=401

 Score =  335 bits (860),  Expect = 8e-115
 Identities = 165/373 (44%), Positives = 239/373 (64%), Gaps = 1/373 (0%)

Query  21   IAGLLSCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQ  80
            I+ LL   T   +     ++Q VD+  K LMAQYQI GMA  + ++G+ ++ NYG+A KQ
Sbjct  28   ISTLLISETAQAADANDRLEQEVDKQAKQLMAQYQIPGMAFGIIVDGKSHFYNYGLADKQ  87

Query  81   TEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNL  140
              Q VSE T+FELGSVSK F ATL  Y++  G L L D   +Y P LKN+A+    L++L
Sbjct  88   RNQPVSEDTIFELGSVSKTFAATLASYSELNGTLSLDDTADKYIPYLKNSAIGNTKLISL  147

Query  141  GTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNS  200
             TY+AGG+  +  + ++  +++ QY++ W P       R YSN SIGL GY++AL+M + 
Sbjct  148  VTYSAGGYHYRCLKTLENNKELLQYYKSWHPDFPVNSKRLYSNASIGLFGYISALSMHSD  207

Query  201  YSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQ-ADQAIRVSPGMFDAEAYGIKSNTA  259
            Y+ LIENT+ P+L M +++++VPA +M +YA+GY  A + IRV+PGM DAEAYGIKS +A
Sbjct  208  YTKLIENTVLPSLKMTNTFVDVPANKMEDYAFGYNAAGEPIRVNPGMLDAEAYGIKSTSA  267

Query  260  DMLKFLDAQINPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSA  319
            DM +F+ A +    +   +++A+   + GY+R     QGL WE Y  P +L  L+ GNS 
Sbjct  268  DMTRFMAANMGLVTVDSQMQQALDNNRKGYYRTKSFTQGLAWEMYPLPTTLQQLVEGNST  327

Query  320  KMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDAR  379
            +  LQPQP+     P        +NKTGATNGF AY+  +P++K G+ +LAN+N+PN  R
Sbjct  328  ETILQPQPIQLNEPPTPVLNDVWVNKTGATNGFGAYIAYMPAKKTGMFILANKNYPNTER  387

Query  380  VKAAYATLQQILN  392
            VKAAY  L  ++N
Sbjct  388  VKAAYTILDSVMN  400


> Q48743 Beta-lactamase [Lysobacter lactamgenus]
Length=385

 Score =  321 bits (822),  Expect = 2e-109
 Identities = 156/358 (44%), Positives = 228/358 (64%), Gaps = 5/358 (1%)

Query  31   AQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTL  90
            A+S     IQ++V       M QYQ+ G+A+ ++++G   Y NYGV+S++T+  V  +TL
Sbjct  24   ARSAADAEIQRAV----AAFMQQYQVPGVAVGITVDGAERYYNYGVSSRKTQAKVGANTL  79

Query  91   FELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPL  150
            FE+GSVSK F ATL  YAQ   QL L+DHP +Y PE+K    ++ TLLNLGT+TAGGFP+
Sbjct  80   FEVGSVSKTFTATLASYAQVNQQLSLADHPGKYLPEMKGHDFDKVTLLNLGTHTAGGFPM  139

Query  151  QFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLF  210
            Q P Q+KT Q +T YFQ W P+      R Y+NP IG++G + A +M+  +   +   L 
Sbjct  140  QVPTQVKTDQQLTAYFQSWHPQYPAGTKRTYANPGIGMLGVIAAKSMRMPFQKAMTGVLL  199

Query  211  PALGMHHSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQI  269
            P LG+ ++Y+ VP A+M+ YA GY    Q +R+SPG      YGIK+   D+L+F++  +
Sbjct  200  PKLGLTNTYLTVPPAKMAFYAQGYDDKGQPVRMSPGALWEPTYGIKTTARDLLRFVEINL  259

Query  270  NPQNLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVT  329
            +   ++P L++AI  T +GY+R+G+M QGL WEQ  YP S T+L A +S K+  +   V 
Sbjct  260  DQVKVEPKLKRAIDGTHVGYYRLGEMTQGLVWEQLPYPASETSLQANSSQKVIFESNAVA  319

Query  330  GISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATL  387
             ++ P       L+NKTG+T GF AYV   P++KIG+V+L NR+ P D R+K A+  L
Sbjct  320  ALTPPRPPQANVLINKTGSTRGFGAYVAFNPARKIGIVLLMNRSVPMDGRIKLAHTIL  377


> P00811 Beta-lactamase [Escherichia coli (strain K12)]
Length=377

 Score =  317 bits (812),  Expect = 6e-108
 Identities = 165/369 (45%), Positives = 237/369 (64%), Gaps = 8/369 (2%)

Query  26   SCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNV  85
            SC T A     Q I   V R   PL+ Q +I GMA+AV   G+ YY  +G A    +Q V
Sbjct  14   SCSTFA---APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPV  70

Query  86   SEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTA  145
            ++ TLFELGSVSK F   L G A A+G++KLSD   +Y+PEL     N  TLL+L TYTA
Sbjct  71   TQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTA  130

Query  146  GGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLI  205
            GG PLQ P+++K++ D+ +++Q+WQP  AP   R Y+N SIGL G +       S+   +
Sbjct  131  GGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAM  190

Query  206  ENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNTADMLKFL  265
            +  +F  L ++H++INVP A+  NYAWGY+  +A+ VSPG  DAEAYG+KS   DM +++
Sbjct  191  QTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWV  250

Query  266  DAQINPQNL-KPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQ  324
             + + P ++ + TL++ IQ  Q  Y++ G M QGLGWE   +PV+  +++ G+  K+AL 
Sbjct  251  QSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINGSDNKIALA  310

Query  325  PQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAY  384
             +PV  I+ P  A + + ++KTGAT GF +YV  IP +++G+VMLAN+N+PN ARV AA+
Sbjct  311  ARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAW  370

Query  385  ATLQQILNA  393
                QILNA
Sbjct  371  ----QILNA  375


> P45460 Beta-lactamase [Yersinia enterocolitica]
Length=388

 Score =  299 bits (765),  Expect = 9e-101
 Identities = 150/366 (41%), Positives = 231/366 (63%), Gaps = 4/366 (1%)

Query  29   TVAQSTVQQ-SIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSE  87
            T+AQ+ + +  +   V+    PL+ +  I GMA+AV  +G+  + NYG+A  +  + V+E
Sbjct  22   TLAQTKLTELQVATIVNNTLTPLLEKQGIPGMAVAVFYDGKPQFFNYGMADIKAGRPVTE  81

Query  88   HTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGG  147
            +TLFELGSVSK F      YA   G + L+D   +Y PEL  +      +L+L TYTAGG
Sbjct  82   NTLFELGSVSKTFTGVAGEYAMQTGIMNLNDPVTEYAPELTGSQWKDVKMLHLATYTAGG  141

Query  148  FPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIEN  207
             PLQ P+ +   + + QY+Q WQP+ AP  +R YSN SIGL G +     + ++ N ++ 
Sbjct  142  LPLQLPDSVTDQKSLWQYYQQWQPQWAPGVMRNYSNASIGLFGALAVKRSQLTFENYMKE  201

Query  208  TLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNTADMLKFLDA  267
             +F  L + H++I +P +  SNYAWGY+  Q +RV+ GM   EAYG+KS + DM++F+ A
Sbjct  202  YVFQPLKLDHTFITIPESMQSNYAWGYKDGQPVRVTLGMLGEEAYGVKSTSQDMVRFMQA  261

Query  268  QINPQNL---KPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQ  324
             ++P++L      L++AI  +Q  YF+ G M QGLGWE Y++P++   ++A +   +AL+
Sbjct  262  NMDPESLPAGNDKLKEAIIASQSRYFQAGDMFQGLGWEMYSWPINPQGVIADSGNDIALK  321

Query  325  PQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAY  384
            P+ V  +     A + + ++KTGATNGF AY+V IP +K+G+VMLAN+N+PN  RV+AAY
Sbjct  322  PRKVEALVPAQPAVRASWVHKTGATNGFGAYIVFIPEEKVGIVMLANKNYPNPVRVQAAY  381

Query  385  ATLQQI  390
              LQ +
Sbjct  382  DILQAL  387


> P18539 Beta-lactamase [Serratia marcescens]
Length=376

 Score =  298 bits (762),  Expect = 2e-100
 Identities = 154/358 (43%), Positives = 221/358 (62%), Gaps = 3/358 (1%)

Query  34   TVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFEL  93
            T   + QQ +D   +PLM +Y + GMAIAVS++G+     YGVASKQT + ++E TLFE+
Sbjct  18   TAHAAQQQDIDAVIQPLMKKYGVPGMAIAVSVDGKQQIYPYGVASKQTGKPITEQTLFEV  77

Query  94   GSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFP  153
            GS+SK F ATL  YAQ Q +L   D  + Y P+++ +A +  +LLNL T+T+ G PL  P
Sbjct  78   GSLSKTFTATLAVYAQQQSKLSFKDPASHYLPDVRGSAFDGVSLLNLATHTS-GLPLFVP  136

Query  154  EQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPAL  213
            + +     +  Y++ WQPK      R YSN  IG++G + A ++   +   +E  + PAL
Sbjct  137  DDVTNNAQLMAYYRAWQPKHPAGSYRVYSNLGIGMLGMIAAKSLDQPFIQAMEQGMLPAL  196

Query  214  GMHHSYINVPAAQMSNYAWGY-QADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQ  272
            GM H+Y+ VPAAQM+NYA GY + D+ +RV+PG  DAE+YGIKSN  D++++LDA +   
Sbjct  197  GMSHTYVQVPAAQMANYAQGYSKDDKPVRVNPGPLDAESYGIKSNARDLIRYLDANLQQV  256

Query  273  NLKPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGIS  332
             +    R+  + T +     G   Q L WE Y YPV L+ L+ GN+A M +   P T I+
Sbjct  257  KVASVARRWPRRTSV-ITSAGAFTQDLMWENYPYPVKLSRLIEGNNAGMIMNGTPATAIT  315

Query  333  KPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
             P    +    NKTG+T GFS Y V IP++ I + MLAN+ FPND RV+AAY  +Q +
Sbjct  316  PPQPELRAGWYNKTGSTGGFSTYAVFIPAKNIAVEMLANKWFPNDDRVEAAYHIIQAL  373


> P05364 Beta-lactamase [Enterobacter cloacae]
Length=381

 Score =  295 bits (755),  Expect = 2e-99
 Identities = 153/377 (41%), Positives = 231/377 (61%), Gaps = 9/377 (2%)

Query  20   CIAGLL--SCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVA  77
            C A LL  SC  +A    ++ + + V     PLM    + GMA+AV   G+ +Y  +G A
Sbjct  7    CCALLLGISCSALATPVSEKQLAEVVANTITPLMKAQSVPGMAVAVIYQGKPHYYTFGKA  66

Query  78   SKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATL  137
                 + V+  TLFELGS+SK F   L G A A+G++ L D   +Y+P+L         +
Sbjct  67   DIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQWQGIRM  126

Query  138  LNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAM  197
            L+L TYTAGG PLQ P+++     + +++Q+WQP+  P   R Y+N SIGL G   ALA+
Sbjct  127  LDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFG---ALAV  183

Query  198  KNS---YSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGI  254
            K S   Y   +   +   L + H++INVP A+ ++YAWGY+  +A+RVSPGM DA+AYG+
Sbjct  184  KPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQAYGV  243

Query  255  KSNTADMLKFLDAQINPQNL-KPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTL  313
            K+N  DM  ++ A + P+N+   +L++ I   Q  Y+R+G M QGLGWE   +PV   T+
Sbjct  244  KTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVEANTV  303

Query  314  LAGNSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRN  373
            + G+ +K+AL P PV  ++ P    + + ++KTG+T GF +YV  IP ++IG+VMLAN +
Sbjct  304  VEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVMLANTS  363

Query  374  FPNDARVKAAYATLQQI  390
            +PN ARV+AAY  L+ +
Sbjct  364  YPNPARVEAAYHILEAL  380


> P05193 Beta-lactamase [Citrobacter freundii]
Length=381

 Score =  293 bits (750),  Expect = 1e-98
 Identities = 148/374 (40%), Positives = 228/374 (61%), Gaps = 3/374 (1%)

Query  20   CIAGLL--SCGTVAQSTVQQSIQQSVDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVA  77
            C A LL  S  T A +  +Q I   V+R   PLM +  I GMA+A+   G+ YY  +G A
Sbjct  7    CCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYYFTWGKA  66

Query  78   SKQTEQNVSEHTLFELGSVSKLFNATLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATL  137
                   V++ TLFELGSVSK FN  L G   A+G++KLSD   +Y+PEL        +L
Sbjct  67   DIANNHPVTQQTLFELGSVSKTFNGVLGGDRIARGEIKLSDPVTKYWPELTGKQWRGISL  126

Query  138  LNLGTYTAGGFPLQFPEQIKTTQDMTQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAM  197
            L+L TYTAGG PLQ P  +    ++ +++Q+WQP+  P   R Y+N SIGL G +   + 
Sbjct  127  LHLATYTAGGLPLQIPGDVTDKAELLRFYQNWQPQWTPGAKRLYANSSIGLFGALAVKSS  186

Query  198  KNSYSNLIENTLFPALGMHHSYINVPAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSN  257
              SY   +   +   L + H++I VP ++  NYAWGY   + + VSPG  DAEAYG+KS+
Sbjct  187  GMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYLEGKPVHVSPGQLDAEAYGVKSS  246

Query  258  TADMLKFLDAQINPQNL-KPTLRKAIQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAG  316
              DM +++ A ++  ++ + TL++ I+  Q  Y+R+G M QGLGWE   +P+   +++ G
Sbjct  247  VIDMARWVQANMDASHVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPLKADSIING  306

Query  317  NSAKMALQPQPVTGISKPITAPQQALLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPN  376
            + +K+AL   P   ++ P  A + + ++KTG+T GF +YV  +P + +G+VMLAN+++PN
Sbjct  307  SDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPN  366

Query  377  DARVKAAYATLQQI  390
             ARV+AA+  L+++
Sbjct  367  PARVEAAWRILEKL  380


> P94958 Beta-lactamase [Morganella morganii]
Length=379

 Score =  292 bits (748),  Expect = 2e-98
 Identities = 152/349 (44%), Positives = 215/349 (62%), Gaps = 2/349 (1%)

Query  43   VDRHFKPLMAQYQISGMAIAVSINGQHYYQNYGVASKQTEQNVSEHTLFELGSVSKLFNA  102
            VD   KPLMAQ  I GMA+AVS+ G+ YY NYG A  Q +Q V+E+TLFELGSVSK F  
Sbjct  31   VDSTIKPLMAQQDIPGMAVAVSVKGKPYYFNYGFADVQAKQPVTENTLFELGSVSKTFTG  90

Query  103  TLTGYAQAQGQLKLSDHPAQYFPELKNTAVNQATLLNLGTYTAGGFPLQFPEQIKTTQDM  162
             L   + A+ ++ L+D   +Y PEL        TLL+L TYTAGG PLQ P+ +K+  D+
Sbjct  91   VLGAVSVAKKEMTLNDPAEKYQPELALPQWKGITLLDLATYTAGGLPLQVPDAVKSRADL  150

Query  163  TQYFQHWQPKAAPRRIREYSNPSIGLMGYVTALAMKNSYSNLIENTLFPALGMHHSYINV  222
              ++Q WQP   P  +R Y+N SIGL G +TA A    Y  L+   +   LG+ H++I V
Sbjct  151  LHFYQQWQPSRKPGDMRLYANSSIGLFGALTANAAGMPYEQLLTARILAPLGLSHTFITV  210

Query  223  PAAQMSNYAWGYQADQAIRVSPGMFDAEAYGIKSNTADMLKFLDAQINPQNL-KPTLRKA  281
            P +  S YA+GY+  + +RVSPG  DAE+YG+KS + DML++ +  + P       L  A
Sbjct  211  PESAQSQYAYGYKNKKPVRVSPGQLDAESYGVKSASKDMLRWAEMNMEPSRAGNADLEMA  270

Query  282  IQTTQMGYFRVGQMRQGLGWEQYTYPVSLTTLLAGNSAKMALQPQPVTGISKPITAPQQA  341
            +   Q  Y++   + QGLGWE Y +P     ++ G + ++ALQP PVT  ++     + +
Sbjct  271  MYLAQTRYYKTAAINQGLGWEMYDWPQQKDMIINGVTNEVALQPHPVTD-NQVQPYNRAS  329

Query  342  LLNKTGATNGFSAYVVVIPSQKIGLVMLANRNFPNDARVKAAYATLQQI  390
             ++KTGAT GF AYV  IP +++ +V+LAN+N+PN  RVKAA A L  +
Sbjct  330  WVHKTGATTGFGAYVAFIPEKQVAIVILANKNYPNTERVKAAQAILSAL  378



Lambda      K        H        a         alpha
   0.319    0.131    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1183776


  Database: ac296478def27596b6a4a5a1918ddc87.SwissProt.fasta
    Posted date:  Oct 19, 2020  5:02 PM
  Number of letters in database: 3,823
  Number of sequences in database:  10



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40