ACIAD3661 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 03861cd1fcead275789902b7214835c0.TrEMBL.fasta
           5 sequences; 287 total letters



Query= ACIAD3661

Length=66
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F6M7 Uncharacterized protein [Acinetobacter baylyi (strain AT...   144    1e-50
  A0A009ZJV5 Uncharacterized protein [Acinetobacter sp. 479375]       59.3    8e-18
  A0A013RRM4 Uncharacterized protein [Acinetobacter baumannii 573...  44.3    4e-12
  A0A1E8E002 Uncharacterized protein [Acinetobacter towneri]          41.6    4e-11
  R8YZW6 Uncharacterized protein [Acinetobacter lactucae]             39.3    2e-10


> Q6F6M7 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=65

 Score =  144 bits (362),  Expect = 1e-50
 Identities = 65/65 (100%), Positives = 65/65 (100%), Gaps = 0/65 (0%)

Query  1   MCLFCISEPVVNKNQKKARHPVELFVSCCLGITPVVPHAPDARTYDDCFAFQNVVFPDVC  60
           MCLFCISEPVVNKNQKKARHPVELFVSCCLGITPVVPHAPDARTYDDCFAFQNVVFPDVC
Sbjct  1   MCLFCISEPVVNKNQKKARHPVELFVSCCLGITPVVPHAPDARTYDDCFAFQNVVFPDVC  60

Query  61  ILDPA  65
           ILDPA
Sbjct  61  ILDPA  65


> A0A009ZJV5 Uncharacterized protein [Acinetobacter sp. 479375]
Length=47

 Score = 59.3 bits (142),  Expect = 8e-18
 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 0/41 (0%)

Query  16  KKARHPVELFVSCCLGITPVVPHAPDARTYDDCFAFQNVVF  56
           KKARHPVEL     LGITPV+PH PDARTY  CF F N +F
Sbjct  2   KKARHPVELSHILRLGITPVIPHDPDARTYHFCFLFWNFLF  42


> A0A013RRM4 Uncharacterized protein [Acinetobacter baumannii 573719]
Length=54

 Score = 44.3 bits (103),  Expect = 4e-12
 Identities = 23/39 (59%), Positives = 24/39 (62%), Gaps = 0/39 (0%)

Query  2   CLFCISEPVVNKNQKKARHPVELFVSCCLGITPVVPHAP  40
           C  CI     NKN KKARHPV LF    L +TPVV HAP
Sbjct  14  CNICIYIQQKNKNIKKARHPVGLFRIWLLDMTPVVSHAP  52


> A0A1E8E002 Uncharacterized protein [Acinetobacter towneri]
Length=91

 Score = 41.6 bits (96),  Expect = 4e-11
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)

Query  16  KKARHPVELFVSCCLGITPVVPH  38
           KKARHPV LF   CLGITPVVPH
Sbjct  46  KKARHPVGLFRIGCLGITPVVPH  68


> R8YZW6 Uncharacterized protein [Acinetobacter lactucae]
Length=30

 Score = 39.3 bits (90),  Expect = 2e-10
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  16  KKARHPVELFVSCCLGITPVVPHAPDA  42
           KKARHPVELF    L +TPVV HAP A
Sbjct  4   KKARHPVELFRIWLLDMTPVVSHAPGA  30



Lambda      K        H        a         alpha
   0.337    0.148    0.524    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11766


  Database: 03861cd1fcead275789902b7214835c0.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:05 AM
  Number of letters in database: 287
  Number of sequences in database:  5



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40