ACIAD3662 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: abffb66c64055a274108d857259a0d6a.TrEMBL.fasta
           14 sequences; 1,792 total letters



Query= ACIAD3662

Length=116
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F6M6 Uncharacterized protein [Acinetobacter baylyi (strain AT...   246    1e-88
  A0A009Y9S1 Uncharacterized protein [Acinetobacter sp. 479375]        233    2e-83
  A0A2N6V7Z6 Uncharacterized protein [Acinetobacter ursingii]          231    1e-82
  A0A0M1I3E2 Membrane protein [Acinetobacter sp. C15]                  218    1e-77
  N9BZI9 Uncharacterized protein [Acinetobacter soli NIPH 2899]        218    1e-77
  A0A1P8EL48 Uncharacterized protein [Acinetobacter soli]              218    1e-77
  R8XX68 Uncharacterized protein [Acinetobacter calcoaceticus ANC...   214    7e-76
  D8JJD8 Uncharacterized protein [Acinetobacter oleivorans (strai...   213    8e-76
  A0A2T5QAE3 Uncharacterized protein [Acinetobacter oleivorans]        213    1e-75
  F0KPF5 Uncharacterized protein [Acinetobacter calcoaceticus (st...   213    1e-75
  A0A0B2UAB0 Membrane protein [Acinetobacter oleivorans]               213    1e-75
  N8ZVT3 Uncharacterized protein [Acinetobacter gerneri DSM 14967...   213    1e-75
  N9RXA8 Uncharacterized protein [Acinetobacter sp. NIPH 542]          213    2e-75
  Q7WWQ8 ABC transporter permease subunit [Lactobacillus acidophi...  37.7    8e-08


> Q6F6M6 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=115

 Score =  246 bits (628),  Expect = 1e-88
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            +NPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD
Sbjct  1    MNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
            QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ
Sbjct  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115


> A0A009Y9S1 Uncharacterized protein [Acinetobacter sp. 479375]
Length=115

 Score =  233 bits (593),  Expect = 2e-83
 Identities = 104/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            +NPT IALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGW+IAL+EYSFMIPATRYLD
Sbjct  1    MNPTLIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWLIALMEYSFMIPATRYLD  60

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
            QQGW+LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CLMGCVYFVFR Q
Sbjct  61   QQGWTLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMLCLMGCVYFVFRGQ  115


> A0A2N6V7Z6 Uncharacterized protein [Acinetobacter ursingii]
Length=115

 Score =  231 bits (588),  Expect = 1e-82
 Identities = 103/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            +NPT IALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGW+IAL+EYSFMIPATRYL+
Sbjct  1    MNPTLIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWLIALMEYSFMIPATRYLN  60

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
            QQGW+LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CLMGCVYFVFR Q
Sbjct  61   QQGWTLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMLCLMGCVYFVFRGQ  115


> A0A0M1I3E2 Membrane protein [Acinetobacter sp. C15]
Length=114

 Score =  218 bits (555),  Expect = 1e-77
 Identities = 100/105 (95%), Positives = 102/105 (97%), Gaps = 0/105 (0%)

Query  11   LIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLDQQGWSLGQMK  70
            LIISNCFMT+AWYGHLKFLHHAPLWQAILFGW IALLEYSFMIPATRYLDQ GWSLGQMK
Sbjct  10   LIISNCFMTLAWYGHLKFLHHAPLWQAILFGWAIALLEYSFMIPATRYLDQHGWSLGQMK  69

Query  71   ITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
            ITQEVVTLLVFTPFMLFMFKQPFK+DYLWAM CLMGCVYFVFRSQ
Sbjct  70   ITQEVVTLLVFTPFMLFMFKQPFKIDYLWAMLCLMGCVYFVFRSQ  114


> N9BZI9 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=114

 Score =  218 bits (555),  Expect = 1e-77
 Identities = 100/105 (95%), Positives = 102/105 (97%), Gaps = 0/105 (0%)

Query  11   LIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLDQQGWSLGQMK  70
            LIISNCFMT+AWYGHLKFLHHAPLWQAILFGW IALLEYSFMIPATRYLDQ GWSLGQMK
Sbjct  10   LIISNCFMTLAWYGHLKFLHHAPLWQAILFGWAIALLEYSFMIPATRYLDQHGWSLGQMK  69

Query  71   ITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
            ITQEVVTLLVFTPFMLFMFKQPFK+DYLWAM CLMGCVYFVFRSQ
Sbjct  70   ITQEVVTLLVFTPFMLFMFKQPFKIDYLWAMLCLMGCVYFVFRSQ  114


> A0A1P8EL48 Uncharacterized protein [Acinetobacter soli]
Length=114

 Score =  218 bits (555),  Expect = 1e-77
 Identities = 100/105 (95%), Positives = 102/105 (97%), Gaps = 0/105 (0%)

Query  11   LIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLDQQGWSLGQMK  70
            LIISNCFMT+AWYGHLKFLHHAPLWQAILFGW IALLEYSFMIPATRYLDQ GWSLGQMK
Sbjct  10   LIISNCFMTLAWYGHLKFLHHAPLWQAILFGWAIALLEYSFMIPATRYLDQHGWSLGQMK  69

Query  71   ITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
            ITQEVVTLLVFTPFMLFMFKQPFK+DYLWAM CLMGCVYFVFRSQ
Sbjct  70   ITQEVVTLLVFTPFMLFMFKQPFKIDYLWAMLCLMGCVYFVFRSQ  114


> R8XX68 Uncharacterized protein [Acinetobacter calcoaceticus ANC 
3811]
Length=120

 Score =  214 bits (544),  Expect = 7e-76
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            L+PT +A   L+ISNCFMT+AWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATR L 
Sbjct  6    LSPTVLAFALLVISNCFMTLAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRMLS  65

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
             QGW LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CL GCVYFVFRSQ
Sbjct  66   AQGWLLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMVCLFGCVYFVFRSQ  120


> D8JJD8 Uncharacterized protein [Acinetobacter oleivorans (strain 
JCM 16667 / KCTC 23045 / DR1)]
Length=115

 Score =  213 bits (543),  Expect = 8e-76
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            ++PT +A   LIISNCFMT+AWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATR L 
Sbjct  1    MSPTVLAFALLIISNCFMTLAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRMLS  60

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
             QGW LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CL GCVYFVFRSQ
Sbjct  61   AQGWLLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMVCLFGCVYFVFRSQ  115


> A0A2T5QAE3 Uncharacterized protein [Acinetobacter oleivorans]
Length=120

 Score =  213 bits (543),  Expect = 1e-75
 Identities = 98/115 (85%), Positives = 104/115 (90%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            L+PT +A   LIISNCFMT+AWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATR L 
Sbjct  6    LSPTVLAFTLLIISNCFMTLAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRMLS  65

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
             QGW LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CL GCVYFVFRSQ
Sbjct  66   AQGWLLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMVCLFGCVYFVFRSQ  120


> F0KPF5 Uncharacterized protein [Acinetobacter calcoaceticus (strain 
PHEA-2)]
Length=120

 Score =  213 bits (543),  Expect = 1e-75
 Identities = 98/115 (85%), Positives = 104/115 (90%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            L+PT +A   LIISNCFMT+AWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATR L 
Sbjct  6    LSPTVLAFTLLIISNCFMTLAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRMLS  65

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
             QGW LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CL GCVYFVFRSQ
Sbjct  66   AQGWLLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMVCLFGCVYFVFRSQ  120


> A0A0B2UAB0 Membrane protein [Acinetobacter oleivorans]
Length=115

 Score =  213 bits (542),  Expect = 1e-75
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            ++PT +A   L+ISNCFMT+AWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATR L 
Sbjct  1    MSPTVLAFALLVISNCFMTLAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRMLS  60

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
             QGW LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CL GCVYFVFRSQ
Sbjct  61   AQGWLLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMVCLFGCVYFVFRSQ  115


> N8ZVT3 Uncharacterized protein [Acinetobacter gerneri DSM 14967 
= CIP 107464]
Length=115

 Score =  213 bits (542),  Expect = 1e-75
 Identities = 97/115 (84%), Positives = 106/115 (92%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            +N T++ALG LIISNCFMT+AWYGHLKFLHHAPLWQAILFGW IALLEYSFMIPATR L 
Sbjct  1    MNVTYLALGFLIISNCFMTLAWYGHLKFLHHAPLWQAILFGWCIALLEYSFMIPATRLLA  60

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
             QGWS+GQMKI+QEVVTLLVF PFM+F+FKQPFKLDYLWA  CL+GCVYFVFRSQ
Sbjct  61   AQGWSMGQMKISQEVVTLLVFVPFMIFLFKQPFKLDYLWAGVCLLGCVYFVFRSQ  115


> N9RXA8 Uncharacterized protein [Acinetobacter sp. NIPH 542]
Length=115

 Score =  213 bits (541),  Expect = 2e-75
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)

Query  1    LNPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLD  60
            ++PT +A   LIISNCFMT+AWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATR L 
Sbjct  1    MSPTVLAFTLLIISNCFMTLAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRMLS  60

Query  61   QQGWSLGQMKITQEVVTLLVFTPFMLFMFKQPFKLDYLWAMACLMGCVYFVFRSQ  115
             QGW LG+MKITQEVVTL+VF PFMLF+FKQPFKLDYLWAM CL GCVYFVFRSQ
Sbjct  61   AQGWLLGEMKITQEVVTLIVFVPFMLFLFKQPFKLDYLWAMVCLFGCVYFVFRSQ  115


> Q7WWQ8 ABC transporter permease subunit [Lactobacillus acidophilus]
Length=285

 Score = 37.7 bits (86),  Expect = 8e-08
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 10/95 (11%)

Query  2    NPTFIALGCLIISNCFMTMAWYGHLKFLHHAPLWQAILFGWIIALLEYSFMIPATRYLDQ  61
            N  F A    I S     +A YG  KF       + +LFG +IALL    +IP T  L Q
Sbjct  82   NSVFYAASVTIGSIVVNALAGYGFAKFNFTG---RKLLFGLLIALL----VIPGTTLLIQ  134

Query  62   Q---GWSLGQMKITQEVVTLLVFTPFMLFMFKQPF  93
            Q     S+G +  +  V+   + +PF ++MF+  F
Sbjct  135  QFQIAKSIGILNTSLAVILPGISSPFYIYMFRNAF  169



Lambda      K        H        a         alpha
   0.341    0.148    0.532    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 117992


  Database: abffb66c64055a274108d857259a0d6a.TrEMBL.fasta
    Posted date:  Sep 18, 2020  3:36 PM
  Number of letters in database: 1,792
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40