ACIAD0028 Sequence

Acinetobacter baylyi ADP1 - chromosome ACIAD.1
>ACIAD0028
ATGAATACTGTCATTGCAGATTTTACCGAACGTGCAGGCACAGGACGTGTTCTGAAAGCA
GAACCTGAGGCCATCCAGCTAGCGCCCGAGCAAACAGCACTGATCGTGGTTGATATGCAA
AATGCCTATACCTCGATTGGAGGATATCTGGACCTCGCGGGTTTTGATGTTTCTAAAACT
AAGCCTGTTGTCGAAAATATTCAAAAAGCAGTTACGGCGGCACATGCTGCTGGCATTCAG
GTAATTTATTTTAAAAATGGTTGGGACAATCAATATGTAGAAGCTGGAGGCGCAGGTTCA
CCTAATTTTCATAAATCCAATGCACTTAAAACCATGCGTAAGCAACCTGAGCTACAAGGC
AAATTACTGGCCAAAGGCGGTTGGGATTTTGAACTGATTGATGAGTTACAGCCGAAAAGC
CAAGATATTGTGATTGAAAAACCACGTTATAGCGGTTTTTTTAATACAGCGCTCGACAGC
ATGTTACGGGCGCGTGGCATTCGTAATCTAGTCTTCGTTGGTATTGCGACCAATGTTTGT
GTGGAGTCGACTTTACGGGATGGATTTTTTCTCGAATATTTTGGAGTGGCGTTAGACGAT
GCTTGTTATCAGGCAGGACCAGTCGAAATGCATCGTGCCAGCATGTACAACATCAAAACC
TTTTTTGGCTGGGTGTCGGATACACAAAGTTTTGTTAATACGTTTCAACACAATCAACAG
CTTGCCAAAACTGCTTAA


>ACIAD0028|ID:146570| putative isochorismatase family protein rutB (Pyrimidine utilization protein B) [Acinetobacter baylyi ADP1]
MNTVIADFTERAGTGRVLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKT
KPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAGGAGSPNFHKSNALKTMRKQPELQG
KLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIATNVC
VESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQ
LAKTA*